CAZyme Information: HMPREF1541_01968-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_01968-t46_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
629		69651.27	4.3652

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822718:1239782-1241973(+)

Full Sequence      

MLSHNVAIEFLWLSSLIALAWSQTDSTSGSSASTATITGTAAATNLATSSDASSSSNTVT
GAAPTGSETASTTSSSPFSTSIGFSLDDFWNIWVGPVEVYSVNTTVEATPVPSAELIPPP
PLNYPSFPTGAVNPAFSKNESWSFPSDFWWGVASAAYQVEGAAKDEGRGPTIWDVFTHRV
KGYTLLNQTGDIANNQYYYYKQDIARIAALGVKVYSFSIAWSRIFPFGRGEVNEQGLAHY
DDVINTCLEYGIQPMVTLYHWDLPLYLQNLYGGWLSEDIVEDFAAYSQVIFDRYHDRVSH
FFTFNEPIVFCNTYPQPVGYFLPTDIPPKQQPFYCGQSVLLAHARAYEIAKSINDSLVVA
VKHNGGYKIPLTNSSEDAVAVQRAWDFNEGWFSNPLFIDGDYPRYLKEYTSTFLRPFNDS
EKARIVNSSDIYAHDAYTSQFYMAPDNGTDACTSNDSHPLFPACVNSTYSYPAEDGGWNI
GYAADPLAPWLHSAADWLPAFLRYIQDTWHPSGGIAITEFGFAEPFEAQKTILADIRTDL
GRSRYYRDYLQAILVAISEGTNVVGCLAWSLVDNLEWAQGYAAKFGMQYVNFTTQERYYK
ASFFEFVDVFGVYQGQGGGQGPGNATVRM

Enzyme Prediction     

No EC number prediction in HMPREF1541_01968-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	143	609	3.7e-130	0.9766899766899767

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	5.72e-123	143	609	4	447	Glycosyl hydrolase family 1.
274539	BGL	2.59e-115	145	604	1	424	beta-galactosidase.
225343	BglB	2.21e-113	144	611	4	451	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215435	PLN02814	1.36e-77	135	597	22	465	beta-glucosidase
215455	PLN02849	9.92e-72	127	597	16	465	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDS77687.1|GH1	1.62e-282	78	610	57	591
ATZ58688.1|GH1	9.02e-278	78	613	32	565
APA15446.1|GH1	2.90e-270	78	613	65	598
QIW95185.1|GH1	3.04e-254	78	614	39	583
CAK40571.1|GH1	1.74e-249	77	613	31	566

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6M4E_A	8.35e-107	77	591	27	547	Crystal structure of a GH1 beta-glucosidase from Hamamotoa singularis [Hamamotoa singularis]
6M55_A	3.29e-106	86	591	5	515	Crystal structure of the E496A mutant of HsBglA in complex with 4-galactosyllactose [Hamamotoa singularis],6M55_D Crystal structure of the E496A mutant of HsBglA in complex with 4-galactosyllactose [Hamamotoa singularis]
7L74_A	4.60e-106	144	591	89	547	Chain A, Beta-hexosyltransferase [Hamamotoa singularis],7L74_B Chain B, Beta-hexosyltransferase [Hamamotoa singularis]
6M4F_A	6.48e-106	77	591	27	547	Crystal structure of the E496A mutant of HsBglA [Hamamotoa singularis],6M4F_C Crystal structure of the E496A mutant of HsBglA [Hamamotoa singularis],6M4F_E Crystal structure of the E496A mutant of HsBglA [Hamamotoa singularis],6M4F_G Crystal structure of the E496A mutant of HsBglA [Hamamotoa singularis]
2RGL_A	5.05e-88	143	609	19	478	Rice BGlu1 beta-glucosidase, a plant exoglucanase/beta-glucosidase [Oryza sativa Japonica Group],2RGL_B Rice BGlu1 beta-glucosidase, a plant exoglucanase/beta-glucosidase [Oryza sativa Japonica Group],2RGM_A Rice BGlu1 beta-glucosidase, a plant exoglucanase/beta-glucosidase [Oryza sativa Japonica Group],2RGM_B Rice BGlu1 beta-glucosidase, a plant exoglucanase/beta-glucosidase [Oryza sativa Japonica Group],7BZM_A Crystal structure of rice Os3BGlu7 with glucoimidazole [Oryza sativa Japonica Group],7BZM_B Crystal structure of rice Os3BGlu7 with glucoimidazole [Oryza sativa Japonica Group]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q75I93|BGL07_ORYSJ	1.27e-87	143	609	42	501	Beta-glucosidase 7 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU7 PE=1 SV=1
sp|Q25BW4|BGL1B_PHACH	5.00e-86	145	602	12	463	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q339X2|BGL34_ORYSJ	6.62e-85	143	602	37	498	Beta-glucosidase 34 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU34 PE=2 SV=1
sp|Q9FZE0|BGL40_ARATH	1.39e-83	143	602	36	498	Beta-glucosidase 40 OS=Arabidopsis thaliana OX=3702 GN=BGLU40 PE=2 SV=1
sp|Q9FIW4|BGL42_ARATH	4.39e-83	143	592	20	460	Beta-glucosidase 42 OS=Arabidopsis thaliana OX=3702 GN=BGLU42 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000640	0.999322	CS pos: 22-23. Pr: 0.9735

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_01968-t46_1-p1.