CAZyme Information: HMPREF1541_01952-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_01952-t46_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
645	KB822718|CGC22	69245.18	8.2788

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822718:1205238-1207175(+)

Full Sequence      

MVHSYNTESATSGTFLPFYLSTARVHPKTPAFARDLNSAGADLNPDTIKLAFAAQPFSRR
NEGLQSYKFHNGTGTLRTAFIPIPSNQSTKRSSFVKVVSRAAIHCAANTKSTGNMHSKTY
THIVVGAGSAGCVVAARIAENRGFDVLLLEAGLDCDPEASEPLVGVRDSRRVPMRGQSEV
FDPALDWNIDVALPHGESMQIPQAKVVGGGSSINGGTALRSTVADSEEWIELGNDRWDFD
SVYQVYESLEDDQLRGTHGPHPIVRASMTEAGKIQRAFLDGAVAAGMPLIQDLNATGAEG
AGPSPVCRRGYRRISAANTFIDPIRNWTNFTILPNSQVDKVFFSGRRASGVLLASGQAFH
ASQEVIICAGAIFSPAILQRSGIGPSRLLEAVQLGVISDLPVGTNLSDHPCIPVVARPRA
GTYQDGDYSLQMQTRWSSSQRPGAIDLQMVCFSYLFVPPLAAHGTRSLAGTATGHVAGIG
CNVNKPTSTGLVAIRSRNATEYPAVTPNYLQTDHDRKAAREVVRRAYRVMTTPAMQRVLE
EPLTLTRRTVDDDDALDGWILSQLSSTYHFCGSCRMAARDRGGVVDQSGRVYGVRGLRVA
DASVIPTVPASNTMWTTVIFAERIGCSIRDGVDVGAASRGGLSRL

Enzyme Prediction     

No EC number prediction in HMPREF1541_01952-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	74	624	4.1e-83	0.558252427184466

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	3.27e-86	115	629	1	532	choline dehydrogenase; Validated
225186	BetA	3.19e-79	114	629	2	534	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	1.32e-71	123	623	4	481	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	4.52e-37	486	624	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	6.76e-29	196	411	16	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMQ46758.1|AA3	1.30e-227	120	645	5	535
SMR43118.1|AA3	1.30e-227	120	645	5	535
SMR45279.1|AA3	1.30e-227	120	645	5	535
SMY20441.1|AA3	5.27e-186	120	578	5	464
CAG5086058.1|AA3_2	2.85e-57	120	623	15	558

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F97_A	6.35e-58	115	628	1	527	Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688],6F97_B Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688]
4UDP_A	3.23e-57	115	628	1	527	Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDP_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDQ_A Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688],4UDQ_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688]
4UDR_A	8.30e-56	115	628	1	527	Crystal structure of the H467A mutant of 5-hydroxymethylfurfural oxidase (HMFO) [Methylovorus sp. MP688],4UDR_B Crystal structure of the H467A mutant of 5-hydroxymethylfurfural oxidase (HMFO) [Methylovorus sp. MP688]
3T37_A	5.19e-45	116	622	14	514	Crystal structure of pyridoxine 4-oxidase from Mesorbium loti [Mesorhizobium loti]
4HA6_A	7.21e-45	123	622	5	498	Crystal structure of pyridoxine 4-oxidase - pyridoxamine complex [Mesorhizobium loti]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7MF12|BETA_VIBVY	2.31e-59	120	623	5	525	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1
sp|C3K3D3|BETA_PSEFS	3.68e-59	117	629	2	534	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=betA PE=3 SV=1
sp|Q8D3K2|BETA_VIBVU	4.43e-59	120	623	5	525	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1
sp|Q6FDF9|BETA_ACIAD	1.42e-58	115	630	1	537	Oxygen-dependent choline dehydrogenase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) OX=62977 GN=betA PE=3 SV=1
sp|C6DKY4|BETA_PECCP	5.88e-58	120	629	3	530	Oxygen-dependent choline dehydrogenase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) OX=561230 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000029	0.000001

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_01952-t46_1-p1.