CAZyme Information: HMPREF1541_01386-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_01386-t46_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
697	KB822711|CGC5	70409.85	3.6826

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822711:3593931-3596511(-)

Full Sequence      

MPSLLSLSLLALISSIIPSTTSAPTKRQFSPGGRRDGAAGNGRWIWGPPSFEPAHWGGPP
NIDNPAADGPEIVSAPAPAPAPAPAPAPEPEPVPVPADTATVAAPALVPPPTESAIPTIP
PPDPIPDDSIPPPPASDPPAAATIATILTSVPAAAATDAPGNTDTLPLSPETDLTATLTD
AAGQTDTVGDVITATSPAEFYTASMPPTVPDADVAPFPNASSPAPAAQESDPAAPNGQPD
VPASSDDGNSTIPPPADAQPAPTIPEPAPGPGPGTDVTVGPGNTLNGTVPGNVPPTSPPQ
STPGLNVELVNNFGSDGINIYITAKDEEGHVMLLTPAQSWLYPTSGSSTIPEPITDDITI
PLGSPGSTTTLNLPGYFNSGRIYFAAGTLRFYTLLNPEGVTLVAPDPQNPSDSSSSILWS
FVEMTYSSVAGLFANLSFVDFVGLAAGMSLTTTSGQTQTVAGTSPGSMGNVCSALEARAG
TDGVPWDQLCVYRGDEVLRVDAPGKYIAAVDGGAFRSYWDAYVTSVWEKYASETLYIDTQ
TDLGVVECSLSCAGASRPLPPPLSSTNPDSALDIFSCAGIFSTTSSDNAVDLAVLPRVCA
ALNRSTFLLARGNTQPSAEVTTADYYYGGGGGGNGTVGQGATNWYSAAVHAAQSDGRGYA
FAYDDVAPFGGVDASGTVAVGGGGVESWKVFVGGMAS

Enzyme Prediction     

No EC number prediction in HMPREF1541_01386-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH64	305	682	9.8e-78	0.9645776566757494

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406796	Glyco_hydro_64	1.16e-115	305	675	3	355	Beta-1,3-glucanase. Family 64 glycoside hydrolases have beta-1,3-glucanase activity.
185759	GH64-GluB-like	1.01e-106	305	675	1	353	glycoside hydrolase family 64: beta-1,3-glucanase B (GluB)-like. This subfamily is represented by GluB, beta-1,3-glucanase B , from Lysobacter enzymogenes Strain N4-7 and related bacterial and ascomycete proteins. GluB is a member of the glycoside hydrolase family 64 (GH64) involved in the cleavage of long-chain polysaccharide beta-1,3-glucans, into specific pentasaccharide oligomers. Among bacteria, many beta-1,3-glucanases are implicated in fungal cell wall degradation. GluB possesses the conserved Glu and Asp residues required to cleave substrate beta-1,3-glucans. Recombinant GluB demonstrated higher relative activity toward the branched-chain beta-1,3 glucan substrate zymosan A than toward linear beta-1,3 glucan substrates. Based on the structure of laminaripentaose-producing, beta-1,3-glucanase (LPHase) of Streptomyces matensis, which belongs to the same family as GluB but to a different subfamily, this cd is a two-domain model. Sometimes these two domains are found associated with other domains such as in the Catenulispora acidiphila DSM 44928 carbohydrate binding family 6 protein in which they are positioned N-terminal of a carbohydrate binding module, family 6 (CBM_6) domain.
185755	GH64-LPHase-like	5.47e-53	305	671	1	338	glycoside hydrolase family 64: laminaripentaose-producing, beta-1,3-glucanase (LPHase)-like. This subfamily is represented by the laminaripentaose-producing, beta-1,3-glucanase (LPHase) of Streptomyces matensis and related bacterial and ascomycete proteins. LPHase is a member of glycoside hydrolase family 64 (GH64), it is an inverting enzyme involved in the cleavage of long-chain polysaccharide beta-1,3-glucans, into specific pentasaccharide oligomers. LPHase is a two-domain crescent fold structure: one domain is composed of 10 beta-strands, eight coming from the N-terminus of the protein and two from the C-terminal region, and the protein has a second inserted domain; this cd includes both domains. This protein has an electronegative, substrate-binding cleft, and conserved Glu and Asp residues involved in the cleavage of the beta-1,3-glucan, laminarin, a plant and fungal cell wall component. Among bacteria, many beta-1,3-glucanases are implicated in fungal cell wall degradation. Also included in this family is GluB , the beta-1,3-glucanase B from Lysobacter enzymogenes Strain N4-7. Recombinant GluB demonstrated higher relative activity toward the branched-chain beta-1,3 glucan substrate zymosan A than toward linear beta-1,3 glucan substrates. Sometimes these two domains are found associated with other domains such as in the Catenulispora acidiphila DSM 44928 carbohydrate binding family 6 protein in which they are positioned N-terminal of a carbohydrate binding module, family 6 (CBM_6) domain. In the Cellulosimicrobium cellulans, glucan endo-1,3-beta-glucosidase, they are positioned N-terminal of a RICIN, carbohydrate-binding domain.
185753	GH64-like	6.17e-26	307	667	3	300	glycosyl hydrolase 64 family. This family is represented by the laminaripentaose-producing, beta-1,3-glucanase (LPHase) of Streptomyces matensis and related bacterial and ascomycete proteins. LPHase is a member of glycoside hydrolase family 64 (GH64), it is an inverting enzyme involved in the cleavage of long-chain polysaccharide beta-1,3-glucans, into specific pentasaccharide oligomers. LPHase is a two-domain crescent fold structure: one domain is composed of 10 beta-strands, eight coming from the N-terminus of the protein and two from the C-terminal region, and the protein has a second inserted domain; this cd includes both domains. This protein has an electronegative, substrate-binding cleft, and conserved Glu and Asp residues involved in the cleavage of the beta-1,3-glucan, laminarin, a plant and fungal cell wall component. Among bacteria, many beta-1,3-glucanases are implicated in fungal cell wall degradation. Also included in this family is GluB , the beta-1,3-glucanase B from Lysobacter enzymogenes Strain N4-7. Recombinant GluB demonstrated higher relative activity toward the branched-chain beta-1,3 glucan substrate zymosan A than toward linear beta-1,3 glucan substrates. Sometimes these two domains are found associated with other domains such as in the Catenulispora acidiphila DSM 44928 carbohydrate binding family 6 protein in which they are positioned N-terminal of a carbohydrate binding module, family 6 (CBM_6) domain. In the Cellulosimicrobium cellulans, glucan endo-1,3-beta-glucosidase, they are positioned N-terminal of a RICIN, carbohydrate-binding domain, and in the Salinispora tropica CNB-440, coagulation factor 5/8 C-terminal domain (FA58C) protein, they are positioned C-terminal of two FA58C domains which are proposed to function as cell surface-attached, carbohydrate-binding domain. This FA58C-containing protein has an internal peptide deletion (of approx. 44 residues) in the LPHase domain II.
236776	PRK10856	0.001	147	251	143	246	cytoskeleton protein RodZ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIW99422.1|GH64	7.08e-91	302	678	65	426
QIW95795.1|GH64	2.40e-86	310	678	70	413
QKX54145.1|GH64	1.10e-84	276	679	40	440
QGA12532.1|GH64	1.30e-82	275	679	34	430
AQA29331.1|GH64	2.36e-82	305	694	80	454

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GD0_A	2.67e-19	342	666	47	344	Chain A, Laminaripentaose-producing beta-1,3-guluase (LPHase) [Streptomyces matensis],3GD9_A Chain A, Laminaripentaose-producing beta-1,3-guluase (LPHase) [Streptomyces matensis]

Swiss-Prot Hits     

HMPREF1541_01386-t46_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000331	0.999634	CS pos: 22-23. Pr: 0.9687

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_01386-t46_1-p1.