CAZyme Information: HMPREF1541_01211-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_01211-t46_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1070		117629.36	5.3445

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822711:3177866-3181135(-)

Full Sequence      

MVITAMRTTPDAYPWPPRSLSAGSRLTWAFVIVLYIFIATVEAISPGELFALRKETEDLF
YHGYENYMNHAFPEDELRPLTCKPLTRDRENPGHFEINDALGNYSLTLIDSLSTLAVLAS
SPSSSKRNKPLLLFQDGVQRLVEQYGDGTDGRRGTGLRAKGFDLDSKVQVFETAIRGLGG
LLSAHLFAVGDLPIRGYSPPPEEAQYARAWQSTSSKPGSGIKWKNGLEYDGQLLRLAHDL
GQRLLPAFWTQTGIPYPRVNLRSGIPFYAKSPLNFDPADGQCELTQQSSGEITETCSAGA
GSLVVEFTVLSRLTGDPRFEELAKRAFWAIWNRRSAIGLIGAGIDAETGNWVSPWTGIGA
GIDSFFEYAFKSFVLLSRDSHPVYKDVEYVKDPRILFGTLLPEEDSPASFYEAWSDAQAA
VKRHIYRGSNYQHPHYIQVDLHTGAARGFWIDALSAFYPGVLALAGQIEEAIETHLLQTA
LWTRFSALPERWNLMTGGIEGGLSWWVGRPEFIESNYHIYRATEDPWYLYVAEMTLRDIK
RRCWARCGWASIQNVLTGEQTDRMESFFLGETAKYLFLTFDPDHPLNHLDEPMVFSTEGH
PLLIPRHVGGGSEQGELYSRPLTEPGQCPIKQKPLPFSISATAARGDVYNAAYLARLHMM
PTRDNIESVLGEYATDHPAINLADLSSPSNYTYFPWTLPPSLVPYNATTALLPTKPTFDI
SFPQLANQGLQPSPPLQRLKEGILINHIGGLKLGMIQDVPSFDEQEEGEAFRIQAINNLA
LGKDEKVYLSRETGQGVLSPSDPNFTRIRDTVMLDLVVDVNTAPVKNTTSSDPLSIDLSD
LVGDISDSAVKSAWGALVNKLSSIMDSSSFPFPIPSSANDAAAALTFSSNSGRKVIPAIT
ATGLGAAPIPAWPDVPATLDPKADLAPQQLPWTRILTAGDLCTHKLPLSAPREHQILLVK
RGGCAFAQKLANIPLFAPSPSSLQLVVVVSYGNDAESGGAGDEEDVLIRPLLEARQVSST
GVDRREGIPLVMVGGGEEVYQRLKSARGVGVRRRWEVRVGGVKVDNLIIL

Enzyme Prediction     

No EC number prediction in HMPREF1541_01211-t46_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	60	602	2e-135	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	2.25e-126	59	604	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	6.39e-57	53	607	73	521	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR91747.1|GH47	0.0	25	1070	14	1111
QSS71303.1|GH47	0.0	15	1070	10	1125
BCS05200.1|GH47	0.0	19	1070	12	1096
BCS16758.1|GH47	0.0	19	1070	12	1096
QSS56460.1|GH47	0.0	15	1070	10	1125

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4AYO_A	1.25e-31	45	580	6	413	Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 [Caulobacter sp. K31],4AYP_A Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 in complex with thiomannobioside [Caulobacter sp. K31],4AYQ_A Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 in complex with mannoimidazole [Caulobacter sp. K31],4AYR_A Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 in complex with noeuromycin [Caulobacter sp. K31],5MEH_A Crystal structure of alpha-1,2-mannosidase from Caulobacter K31 strain in complex with 1-deoxymannojirimycin [Caulobacter sp. K31],5NE5_A Crystal structure of family 47 alpha-1,2-mannosidase from Caulobacter K31 strain in complex with kifunensine [Caulobacter sp. K31]
5KKB_A	1.12e-28	53	606	23	469	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	1.26e-28	53	606	21	467	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]
1FMI_A	1.02e-27	45	604	3	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	1.05e-27	45	604	3	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94726|MNL1_SCHPO	3.30e-116	31	600	12	473	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mnl1 PE=3 SV=2
sp|Q92611|EDEM1_HUMAN	2.57e-107	46	621	123	615	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Homo sapiens OX=9606 GN=EDEM1 PE=1 SV=1
sp|Q925U4|EDEM1_MOUSE	4.41e-106	46	608	118	585	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Mus musculus OX=10090 GN=Edem1 PE=1 SV=1
sp|P38888|MNL1_YEAST	2.89e-98	45	608	28	506	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNL1 PE=1 SV=1
sp|Q9SXC9|MNS5_ARATH	9.21e-87	52	604	37	478	Alpha-mannosidase I MNS5 OS=Arabidopsis thaliana OX=3702 GN=MNS5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.211823	0.788183	CS pos: 43-44. Pr: 0.7207

TMHMM  Annotations     

Start	End
21	43