CAZyme Information: HMPREF1541_00996-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_00996-t46_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
454	KB822711|CGC19	48562.73	4.7579

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822711:2618864-2620374(-)

Full Sequence      

MLPRSLLRTLLPALGCLAQLSASSPLESVYQSNIRSIRRNDVLEDRNTQLLRLSEDDASN
ETEGQDASWLHEHSKLERADLDRLLGELGLTYGDARELVKRYAGTDPVCTSAGPSSTAAP
TSQPTSTAPVSAGARNMNVVYYAQTPATNQVPLSDICRDPNVDIVILSFITDFYSAGGYP
MLNLGPRCWAANSVQQAAGATGLLDCVGDGFANQVAACQQAGKKMMLSVGGAIATNDLPS
AQAATTAAQMIWDLFLGGSDARLQPLRPFGPNIKLDGIDIDNEAPAYSTYIPEFVSALRT
LYAQDSSKQYFLSAAPQCPRPDQSIPMPQIIPDLDYVFVQFYNNPQCNVNAGTGFLNSLQ
SWSQDLLAASPGAPRRRRAMVNSGRPPPKVFIGVLAAEGSGHVTPAELMTILNTVKGLNI
PNLGGVSYWDGAYQALSGQGGQKSYAEVVRETLA

Enzyme Prediction     

EC	3.2.1.14:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	138	400	1.3e-24	0.6587837837837838

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119356	GH18_hevamine_XipI_class_III	1.87e-69	139	451	4	280	This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.
395573	Glyco_hydro_18	8.25e-15	139	435	3	266	Glycosyl hydrolases family 18.
119350	GH18_chitinase_D-like	4.30e-11	163	438	29	289	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
119349	GH18_chitinase-like	9.06e-10	139	362	1	190	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
226000	Chi1	1.82e-05	211	454	87	326	Chitinase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX63087.1|GH18	1.18e-57	131	453	31	324
QGA21602.1|GH18	1.21e-53	136	430	30	301
ADF57308.1|GH18	1.20e-52	139	430	33	299
QED08861.1|GH18	2.18e-52	153	430	39	291
AAZ23949.1|GH18	2.18e-52	153	443	39	304

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2GSJ_A	2.72e-33	139	430	4	254	cDNA cloning and 1.75A crystal structure determination of PPL2, a novel chimerolectin from Parkia platycephala seeds exhibiting endochitinolytic activity [Parkia platycephala]
2UY2_A	1.69e-32	136	453	5	287	ScCTS1_apo crystal structure [Saccharomyces cerevisiae],2UY3_A ScCTS1_8-chlorotheophylline crystal structure [Saccharomyces cerevisiae],2UY4_A ScCTS1_acetazolamide crystal structure [Saccharomyces cerevisiae],2UY5_A ScCTS1_kinetin crystal structure [Saccharomyces cerevisiae],4TXE_A ScCTS1 in complex with compound 5 [Saccharomyces cerevisiae]
1HVQ_A	2.38e-28	140	438	5	264	CRYSTAL STRUCTURES OF HEVAMINE, A PLANT DEFENCE PROTEIN WITH CHITINASE AND LYSOZYME ACTIVITY, AND ITS COMPLEX WITH AN INHIBITOR [Hevea brasiliensis],1LLO_A Chain A, HEVAMINE [Hevea brasiliensis],2HVM_A Hevamine A At 1.8 Angstrom Resolution [Hevea brasiliensis]
1KR1_A	2.24e-27	140	438	5	264	Chain A, Hevamine A [Hevea brasiliensis]
1KR0_A	2.24e-27	140	438	5	264	Chain A, Hevamine A [Hevea brasiliensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6QDR4|CHI3_METAN	2.88e-52	132	439	9	291	Endochitinase 3 (Fragment) OS=Metarhizium anisopliae OX=5530 GN=chi3 PE=1 SV=1
sp|E9ENC6|CHI3_METRA	2.09e-50	135	430	28	299	Endochitinase 3 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chi3 PE=3 SV=1
sp|P40954|CHI3_CANAL	2.22e-32	136	430	22	288	Chitinase 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CHT3 PE=1 SV=2
sp|P40953|CHI2_CANAL	2.15e-31	132	430	19	279	Chitinase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CHT2 PE=1 SV=2
sp|P36908|CHIA_CICAR	1.58e-30	140	438	28	284	Acidic endochitinase OS=Cicer arietinum OX=3827 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.133777	0.866203	CS pos: 23-24. Pr: 0.5543

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_00996-t46_1-p1.