CAZyme Information: HMPREF1541_00799-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_00799-t46_1-p1
• CAZy Family: AA2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
884	KB822711|CGC21	98591.97	5.2538

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822711:2131005-2133659(+)

Full Sequence      

MFRMRRFRLFVLITVILVGSVYELYHLNNWDVPDLESLAGLHGFKNDGPQAPVNPDQGVP
VPVPPPAPPASGPPPAEPAAPEQPPPADPKVDAAPPAAKPEEPETPKIESAKPAKPSSSA
TSTSIAFAAQKTITGEEFLKKQPQDFELSQQDQGRLDVKPWPQDKPKARWHPQSEHFPVQ
KVIGMPPGEARALPKIQHSFGSESSTTKKDRLMKQTAVREAFKHAWNGYKTYALPHDELK
PLSNDTADPFNGWGATLVDSLDTMWMMGLQDEFEEAVGNVTNIDFKTSTRKDLPLFETTI
RYLGGLLGAYDISQAKYPILLEKAVELADVIMGAFDTPNRMPIPFYQWAPSYASQPHRSS
SHIVMAELGSLAVELTRLSQITKEEKYYDAIARVTDALEEWQDSTSFPGVWPVKLDSSGC
KKPNFDSDHSLDGSTAKGNAGGLAKRQMDDAPKQEPKTEKQDKPAAGEVGIEVGIGEEPA
ESVSHGEDDEDTFSIDCVKQGLAHEPNAKTHVYSIAAMADSTYEYFPKMHALLGGRTPQY
RNMYLNSMDTIRKHFLFRPMIKDEKRDVRFLAKQKIRPNPRGNEKKRETDYEGTHLGCFV
GGMFALGSKVFDTPSDMEMAEKLTDGCVWAYESTPLGIMAEEFLLTPCADDKDCPWDEKR
WHEHLDPNKQERFEAVERYNAQQKALTEGTTPSSEERLDPASKSKRQDMGGSISNPAPSR
TLNVEDEHHEDAGYGHAHAADSGAYFIPKVALSHEKYVAARISEERLPPSYTKIKSRAYK
LRPEAIESVFIMYRLTGDQKWRDKGWAMFQAVEPAARTGAGHATVRDVTSQLGEVEDTME
SFWLAETLKYFWLLFAEEDVLSLDEWVLNTEAHGMRIPKAGQMG

Enzyme Prediction     

EC	3.2.1.113:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	221	876	1.4e-168	0.9955156950672646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	0.0	221	877	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	3.91e-103	173	879	26	520	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX63570.1|GH47	3.40e-219	144	878	143	897
BCS01562.1|GH47	1.94e-213	109	879	95	870
BCS13278.1|GH47	1.94e-213	109	879	95	870
CAK47995.1|GH47	4.73e-211	101	879	89	869
BAE54674.1|GH47	9.50e-206	151	878	122	849

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1KKT_A	3.27e-49	196	879	19	510	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
2RI8_A	1.02e-48	214	879	5	475	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1HCU_A	1.68e-44	217	884	18	499	Chain A, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_B Chain B, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_C Chain C, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_D Chain D, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei]
5KIJ_A	1.35e-43	214	877	5	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	1.52e-43	214	877	10	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AV26|MNS1B_ARTBC	1.01e-49	192	877	18	507	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase ARB_00035 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00035 PE=1 SV=1
sp|P31723|MAN12_PENCI	1.68e-48	196	879	19	510	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Penicillium citrinum OX=5077 GN=MSDC PE=1 SV=2
sp|O18498|MA1A1_SPOFR	1.67e-46	172	873	173	640	Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Spodoptera frugiperda OX=7108 PE=1 SV=1
sp|A1CP08|MNS1B_ASPCL	3.07e-46	176	877	2	508	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mns1B PE=3 SV=1
sp|Q8H116|MNS2_ARATH	1.59e-45	218	877	102	537	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana OX=3702 GN=MNS2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999968	0.000049

TMHMM  Annotations     

Start	End
7	26