CAZyme Information: HMPREF1541_00594-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_00594-t46_1-p1
• CAZy Family: AA2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
330	KB822711|CGC7	37031.23	5.8113

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822711:1614314-1615306(+)

Full Sequence      

MPPIPPSQTALPGWQPRVVCYQQTYHHEDEYISLLPLITNGPPAVTHVILAAIHINWDPN
NLTLNDNPPDHPKYTQLWDEAMVLQDSGIKVLGMLGGAAKGSFARLDYSESRTDVPLARF
EAYYAPLREMIRTYSLDGLDLDVEEEMSLPGVVNLIDRLKADFGQDFIITLAPVATALMA
GRPHLSGFDYSLLEAARGSSIAWYNTQFYNGWGGLESPRAYDEIMRNGWRPEKVVAGMLT
NPRHGGSGYVLLHHTAAVLSYLQEKYPAFGGVMGWEYWASLPNEQEVWQWPYCMRLILGL
KEVRDAAIIVTMGRGLSRSNMNQGRVPRTR

Enzyme Prediction     

EC	3.2.1.96:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	17	246	2.7e-18	0.6722972972972973

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119363	GH18_CTS3_chitinase	4.42e-134	17	277	1	253	GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii. CTS3 has a chitinase-like glycosyl hydrolase family 18 (GH18) domain; and has homologs in bacteria as well as fungi.
119349	GH18_chitinase-like	2.16e-18	18	210	1	177	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
119350	GH18_chitinase_D-like	3.22e-15	84	275	69	293	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
395573	Glyco_hydro_18	4.39e-09	17	212	1	181	Glycosyl hydrolases family 18.
119356	GH18_hevamine_XipI_class_III	2.99e-07	43	279	23	268	This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS58282.1|GH18	3.09e-120	11	290	4	282
QVM11529.1|GH18	5.63e-118	1	307	1	302
AAO88269.1|GH18	7.48e-116	1	307	1	302
ALI93551.1|GH18	4.14e-112	1	298	1	290
ANH56426.1|GH18	4.14e-112	1	298	1	290

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Y8V_A	3.67e-109	1	296	3	286	Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_B Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_C Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_D Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293]
4AC1_X	4.15e-78	16	298	3	279	Chain X, ENDO-N-ACETYL-BETA-D-GLUCOSAMINIDASE [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P27050|CHID_NIACI	6.75e-06	84	285	252	502	Chitinase D OS=Niallia circulans OX=1397 GN=chiD PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_00594-t46_1-p1.