CAZyme Information: HMPREF1541_00391-t46_1-p1

Basic Information

• Species: Cyphellophora europaea
• Lineage: Ascomycota; Eurotiomycetes; ; Cyphellophoraceae; Cyphellophora; Cyphellophora europaea
• CAZyme ID: HMPREF1541_00391-t46_1-p1
• CAZy Family: AA11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
851		96609.10	6.4792

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CeuropaeaCBS101466	11153	1220924	59	11094

• Gene Location: location=KB822711:1110046-1112698(-)

Full Sequence      

MSSSGQSLQLFTVDLKHGWQFKQTNDDSKNAWLPVKQVPSTVHQDLIDNKKLDDPFVGFN
EIKAEWVGTTAWTYQTEFTSPQVPSGSVAVLAFDGLDTFAHVKLNGLTILKADNMFFPYR
VDITKALARADKHTLEIEFESAILKGQEIKKQHPEHKWVGFNGDMGRLAVRKAQYHWGWD
WGPILNCAGIWRPARIEVYQSRISDLRTDVVIADDYKSATVHVSASIESHSKDGLTAEFI
VRSASQVVARSEVEVATSRSTTAELRIANPELWMPNGYGNQTFYHVDISLKSGAATLHKD
TRRLGIRKVELVQQADKHGKSFFFRINGVDIFCGGSCWIPADSFLTNIKPERYRSWIELM
VPANQKMIRVWGGGIYEDDAFYDACDELGILVWQDFMFGCGNYPCYPAMLDSVKAEAIAN
VKRLRHHPCMAIFAGNNEDYQVQEACNLDYDYEDKNHDNWLKSNFPARYIYESLLPKVMS
SEAPAIPYHPGSPWGDGKRSSDPTVGDIHQWNVWHGTQEKYQIFDSLGGRFNSEFGMEAF
PHIDTIKTFVEKEEDLFPQSHVLDFHNKADGHERRIATYLVENVRSNPELKAYIHLTQLI
QCEALMFGYRGWRRQWGDDRRCGGALVWQLDDCWPVTSWAIVDYYLRRKPAYYAMARVLA
PVAVGIRRQHHDWSVTHAREPKTQEWELWAVSSKLDQVSADLEVRFISVKTGKEIKEKIV
QKGVKLTANGSTDVARGQVDNVSEEPHVLAARLWIGGKLVARDTDWPQPLKYLAFPERNV
RVTVQSQGQGSEMHVSVDRPVKCLVFEEREGCHLSDSAIDVVPGDDQVITARGVREGDKA
LGWTYLGAGEQ

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	12	780	1e-96	0.7446808510638298

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	1.02e-78	14	664	14	634	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407658	Mannosidase_ig	9.52e-18	684	772	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
236657	PRK10150	3.97e-13	59	438	51	417	beta-D-glucuronidase; Provisional
395572	Glyco_hydro_2	2.35e-09	202	307	2	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS23201.1|GH2	0.0	15	847	9	842
QKX54479.1|GH2	0.0	12	848	6	845
QRC92248.1|GH2	0.0	10	847	19	850
ABF50864.1|GH2|3.2.1.25	0.0	15	847	9	842
QKX60969.1|GH2	0.0	8	847	1	843

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	2.56e-138	7	823	23	802	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	1.76e-127	15	839	11	826	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	1.85e-127	1	839	1	828	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	1.90e-127	1	839	1	828	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	4.97e-127	15	839	11	826	Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CCA0|MANBB_ASPTN	0.0	10	847	4	842	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
sp|Q4WAH4|MANBB_ASPFU	0.0	9	847	3	844	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
sp|B8NW36|MANBB_ASPFN	0.0	15	847	9	843	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
sp|B0YBU9|MANBB_ASPFC	0.0	9	847	3	844	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
sp|Q2TXB7|MANBB_ASPOR	0.0	15	847	9	843	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HMPREF1541_00391-t46_1-p1.