CAZyme Information: HCEG_08214-t36_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCEG_08214-t36_1-p1
• CAZy Family: GT34
• CAZyme Description: glycogen phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
885	DS990642|CGC4	100171.78	5.9180

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumH88	9666	544711	221	9445

• Gene Location: location=DS990642:1248441-1251615(+)

Full Sequence      

MTSPTRERRPSIGAPISDLQGPVGPGFSRPKHKRTFTGLLPQDIKKVEASIPEPQREAWR
KFKEVVRHVETTLARSLFNCDELAAYSGTALAFRDRLIIEWNKTQQRQTFADQKRVYYLS
LEFLMGRALDNAMLNVGLKQVARGMIPVPGPKVTTNATIVDGLKDLGFRIEDVVSQEHDA
ALGNGGLGRLAACFLDSLASLNYPAWGYGLRYRYGIFKQEIINGYQIEVPDYWLDFNPWE
FPRHDVTVDIQFYGSVRKYQDENGKTNYSWEDGEIVQAVAYDVPIPGYATPTTNNLRLWS
SKAASGEFDFQKFNAGEYESAVTDQQRAETISAVLYPNDSLDRGKELRLKQQYFWCAASL
YDIVRRFKKTKRAWSEFPDQVAIQLNDTHPTLAIVELQRILIDQEGLEWNAAWTIVSSTF
GYTNHTVLPEALEKWSVPLIQTLLPRHLQIIYDINLLFLQMVEKMFPKDRDLLRNVSIIE
ESQPKMVRMAHLAIIGSHKVNGVAELHSDLIKTTIFKDFVEIYGPDKFTNVTNGITPRRW
LHQANPRLSNLIASKLGDGFLKDLTLLDKLEAYIDDESFRREWADIKHANKVRLANHIFS
TTGIRVDPKALFDIQVKRIHEYKRQQLNIFGVIHRYLKIKAMSANERAKLVPRVSIFGGK
AAPGYWMAKSIIHLINQVGSVVNSDPDVGDLLKVIFVEDYNVSKAEMICPASDISEHIST
AGTEASGTSNMKFVLNGGLIIGTCDGANIEITREIGEQNIFLFGTLAEDVEDLRHAHIYE
KDNVTLGNDLTAVFDTIKSGTFGDASSFSALISAITEHGDYYLVSDDFHSYITTQDMVDE
AYRDQDGWLERCILSVSRMGFFSSDRVIAEYADSIWNIEPVDAPE

Enzyme Prediction     

EC	2.4.1.1:158

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	163	879	1.3e-281	0.9970326409495549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184948	PRK14986	0.0	89	881	45	813	glycogen phosphorylase; Provisional
223136	GlgP	0.0	64	880	12	750	Glucan phosphorylase [Carbohydrate transport and metabolism].
237881	PRK14985	0.0	107	876	52	794	maltodextrin phosphorylase; Provisional
273967	P_ylase	0.0	65	878	1	794	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
340853	GT35_Glycogen_Phosphorylase	0.0	63	878	2	795	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS54596.1|GT35	0.0	1	885	1	880
QSS74747.1|GT35	0.0	1	885	1	880
QSS59486.1|GT35	0.0	1	885	1	782
CAK45551.1|GT35	0.0	4	882	6	878
BCS09645.1|GT35	0.0	4	882	6	878

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1YGP_A	0.0	30	881	1	878	Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site. [Saccharomyces cerevisiae],1YGP_B Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site. [Saccharomyces cerevisiae]
4BQE_A	8.28e-276	82	884	85	874	Arabidopsis thaliana Cytosolic Alpha-1,4-glucan Phosphorylase (PHS2) [Arabidopsis thaliana],4BQE_B Arabidopsis thaliana Cytosolic Alpha-1,4-glucan Phosphorylase (PHS2) [Arabidopsis thaliana],4BQF_A Arabidopsis thaliana cytosolic alpha-1,4-glucan phosphorylase (PHS2) in complex with acarbose [Arabidopsis thaliana],4BQF_B Arabidopsis thaliana cytosolic alpha-1,4-glucan phosphorylase (PHS2) in complex with acarbose [Arabidopsis thaliana],4BQI_A ARABIDOPSIS THALIANA cytosolic alpha-1,4-glucan phosphorylase (PHS2) in complex with maltotriose [Arabidopsis thaliana],4BQI_B ARABIDOPSIS THALIANA cytosolic alpha-1,4-glucan phosphorylase (PHS2) in complex with maltotriose [Arabidopsis thaliana]
3CEH_A	6.80e-266	63	882	7	809	Human liver glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE5688 [Homo sapiens],3CEH_B Human liver glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE5688 [Homo sapiens],3CEJ_A Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE2865 [Homo sapiens],3CEJ_B Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE2865 [Homo sapiens],3CEM_A Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE9423 [Homo sapiens],3CEM_B Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE9423 [Homo sapiens]
1FC0_A	2.38e-265	63	882	29	831	HUMAN LIVER GLYCOGEN PHOSPHORYLASE COMPLEXED WITH N-ACETYL-BETA-D-GLUCOPYRANOSYLAMINE [Homo sapiens],1FC0_B HUMAN LIVER GLYCOGEN PHOSPHORYLASE COMPLEXED WITH N-ACETYL-BETA-D-GLUCOPYRANOSYLAMINE [Homo sapiens],2ATI_A Glycogen Phosphorylase Inhibitors [Homo sapiens],2ATI_B Glycogen Phosphorylase Inhibitors [Homo sapiens]
1XOI_A	2.38e-265	63	882	29	831	Human Liver Glycogen Phosphorylase A complexed with Chloroindoloyl glycine amide [Homo sapiens],1XOI_B Human Liver Glycogen Phosphorylase A complexed with Chloroindoloyl glycine amide [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P06738|PHSG_YEAST	0.0	30	881	24	901	Glycogen phosphorylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPH1 PE=1 SV=4
sp|Q00766|PHS1_DICDI	1.30e-307	34	882	12	844	Glycogen phosphorylase 1 OS=Dictyostelium discoideum OX=44689 GN=glpV PE=1 SV=3
sp|P34114|PHS2_DICDI	2.45e-283	63	884	116	913	Glycogen phosphorylase 2 OS=Dictyostelium discoideum OX=44689 GN=glpD PE=1 SV=2
sp|Q9SD76|PHS2_ARATH	1.39e-275	82	884	52	841	Alpha-glucan phosphorylase 2, cytosolic OS=Arabidopsis thaliana OX=3702 GN=PHS2 PE=1 SV=1
sp|P53537|PHSH_VICFA	4.28e-272	68	884	40	842	Alpha-glucan phosphorylase, H isozyme OS=Vicia faba OX=3906 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000084	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HCEG_08214-t36_1-p1.