CAZyme Information: HCEG_07873-t36_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCEG_07873-t36_1-p1
• CAZy Family: GT32
• CAZyme Description: GPI mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
441	DS990641|CGC6	49033.72	9.8353

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumH88	9666	544711	221	9445

• Gene Location: location=DS990641:2440905-2442321(-)

Full Sequence      

MPSIFGSPTLVFSAAVILRVILLFYGLFQDSHSPVKYTDIDYFVFTDAAKFVSQGRSPYE
RATYRYTPLLAWLLVPTAWGGNLWSVFGKALFAFADIVAGWLIVRVLRQQRHLNMDMPRA
LKYASIWLLNPMVATISTRGSSEGLLGVMVIALVWAVLEKRIVLAGTLLGLGVHFKIYPF
IYAPSIIWMLDEGGSHVGEISNLSLSSMINWLRSFFNPSRILLTFASLCVFSALNLSMYV
TYGLPFMQHTYLHHLTRVDHRHNFSPYNMLLYLSSSSTAQGTSLGSNLESVAFIPQLALS
AALIPLALAKKDLAGTMLAQTFAFVTFNKVCTSQYFLWYMIFLPLYLPYSLFVKKPLLGI
SALTLWIGGQALWLYQGFRLEFHGLSTFAPGLFLASLIFFLVNVWILGIIVADVGVQSVS
SFAMRASGDPSKATKAAGDQK

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	136	410	8.5e-92	0.9923664122137404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	5.42e-88	7	411	8	415	GPI mannosyltransferase
252941	Mannosyl_trans	7.46e-73	136	411	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.
399599	PIG-U	1.06e-04	55	256	47	243	GPI transamidase subunit PIG-U. Many eukaryotic proteins are anchored to the cell surface via glycosylphosphatidylinositol (GPI), which is posttranslationally attached to the carboxyl-terminus by GPI transamidase. The mammalian GPI transamidase is a complex of at least four subunits, GPI8, GAA1, PIG-S, and PIG-T. PIG-U is thought to represent a fifth subunit in this complex and may be involved in the recognition of either the GPI attachment signal or the lipid portion of GPI.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS50664.1|GT50	4.01e-313	1	441	1	441
QSS62928.1|GT50	5.83e-306	1	441	1	441
QSS74503.1|GT50	5.83e-306	1	441	1	441
QKX64577.1|GT50	2.91e-182	1	415	1	416
BCS05340.1|GT50	2.86e-178	3	418	10	423

PDB Hits     

HCEG_07873-t36_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2TXB8|GPI14_ASPOR	2.20e-178	1	417	1	413	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q5B7W0|GPI14_EMENI	1.04e-173	1	421	1	435	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1
sp|Q4WAH2|GPI14_ASPFU	1.12e-173	1	415	1	422	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1
sp|Q4I073|GPI14_GIBZE	9.10e-160	1	421	1	415	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1
sp|Q7S4Z3|GPI14_NEUCR	1.92e-157	1	415	19	486	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000023	0.000001

TMHMM  Annotations     

Start	End
10	28
69	88
136	158
165	187
221	243
335	352
356	378
390	412