CAZyme Information: HCEG_06474-t36_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCEG_06474-t36_1-p1
• CAZy Family: GH92
• CAZyme Description: alpha 1,6 mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
404		45824.26	6.8227

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumH88	9666	544711	221	9445

• Gene Location: location=DS990640:1924895-1926241(+)

Full Sequence      

MITFRRSIAATLLLLASFYFLLSSRSHSCFRLCHPHPLPIRKAAQKSVAASSESPPSTHN
ESLPPTSAAASLSPEDLARKPLRERLRYQFPYDVHAKFPAYIWQTWKYTPASGKFGDKFR
PMEASWTELHPSFVHEVITDDDADPLLRYLYAPFPEILDAYRSLPLPVLRADFFRYLILL
ARGGIYTDIDTYALKPTIEWLPPHVDRSAIGLIVGIEADAHDREDWYLWYSRQLQFCQWT
IQAKPGHPVLRDIVATITEDTLRMKRAGILRPGIMDRSIVEFTGPAVWTDCVFRYLNDPE
YFEAARPPHGRNLTAKDFAGITVQRKVGDVVVLPITSFSPGVGQMGAQDAGDPMAFVLHQ
FEGSWKGEAEEDEDKELHQNAADIIAQSALDIIRRTKNGQRKTE

Enzyme Prediction     

EC	2.4.1.257:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	123	202	1.2e-19	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	7.37e-44	79	366	63	345	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	3.48e-18	125	202	10	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS53427.1|GT32	6.95e-302	1	404	1	404
QSS75991.1|GT32	7.46e-297	1	404	1	404
QKX63547.1|GT32	1.80e-151	70	370	65	361
QVM11372.1|GT32	4.65e-149	75	366	61	353
ABA38731.1|GT32	5.00e-147	75	363	32	321

PDB Hits     

HCEG_06474-t36_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	6.53e-85	82	366	83	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	9.27e-68	88	366	132	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	5.12e-67	75	366	103	388	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	7.96e-67	82	370	80	474	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P38287|CSH1_YEAST	4.61e-06	128	190	88	147	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.996036	0.003983

TMHMM  Annotations     

Start	End
7	24