CAZyme Information: HCEG_05250-t36_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCEG_05250-t36_1-p1
• CAZy Family: GH47
• CAZyme Description: immunodominantigen Gp43

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
416	DS990639|CGC4	46173.31	9.6681

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumH88	9666	544711	221	9445

• Gene Location: location=DS990639:2727678-2729007(-)

Full Sequence      

MAPLKSLKLAFVCLSLTWVSIASAATHVVRRQSTHKSSIRGVNLGGWLVLEPWITPSVFE
KAGDRAVDEYTLSQILAGNARSRLSEHWNSWITADDFKQIAAAGLTHVRIPIGYWAVAPL
KGEPYVQGQVSYLDKAIKWARQSNLKVAIDLHGAPGSQNGFDNSGRRGSINWPKGNTVAQ
TLNALRALAERYADQTDVVDSIEILNEPFVPGGVPLDEVKQFYHKGYKVVRDINPNVGVA
ISDAFQDLRSWNGFMLPSKNFHNVFLDAHHYQVFDNAFTSFSVDQHVNLACSYGREQVAK
TDKKTFVGEWSAAMTDCAKYLNGRGKGARFDKSFPNGKRSGACGGRYFGSVKQLPDQQKV
GIRRFIEAQLDAYGLGAGWFFWTWKTEGSPGWDMRDLLSAGLFPQPFTDRKYGGCK

Enzyme Prediction     

EC	3.2.1.58:29	3.2.1.21:6	3.2.1.75:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	86	387	2.2e-115	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	9.53e-69	39	414	18	392	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	1.36e-11	87	310	15	236	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS56663.1|GH5_9	1.37e-317	1	416	1	416
QSS71511.1|GH5_9	8.01e-314	1	416	1	416
QSS61799.1|GH5_9	1.42e-307	1	416	1	416
AAG36698.1|GH5_9	9.50e-188	5	416	4	416
AAC49253.2|GH5_9	9.50e-188	5	416	4	416

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	4.54e-122	39	412	9	387	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	3.67e-121	39	412	9	387	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	4.46e-121	39	412	15	393	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PC8_A	1.27e-120	39	412	15	393	Chain A, Hypothetical protein XOG1 [Candida albicans]
2PBO_A	1.27e-120	39	412	15	393	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1D4Q5|EXGA_NEOFI	1.12e-157	13	412	14	411	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1
sp|B0XN12|EXGA_ASPFC	1.12e-157	26	412	27	411	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
sp|Q4WK60|EXGA_ASPFU	1.58e-157	26	412	27	411	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
sp|D4AJL7|EXG1_ARTBC	1.65e-156	14	414	9	410	Probable glucan 1,3-beta-glucosidase ARB_04467 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_04467 PE=1 SV=1
sp|Q5B5X8|EXGA_EMENI	1.44e-155	21	412	11	399	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000423	0.999555	CS pos: 24-25. Pr: 0.9585

TMHMM  Annotations     

There is no transmembrane helices in HCEG_05250-t36_1-p1.