CAZyme Information: HCEG_05006-t36_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCEG_05006-t36_1-p1
• CAZy Family: GH43
• CAZyme Description: beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
855	DS990639|CGC7	97732.62	5.4885

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumH88	9666	544711	221	9445

• Gene Location: location=DS990639:2005118-2007832(+)

Full Sequence      

MTECRVIPLNKGWVFRQADDEKAEFLPVSQFPTNVHLDLMHHGLIADPFLGKNEFDVQWV
GEKAWVYTTSFDTPALKGGEKAVLAFGGLDTHATVRLNATKILETENMFIPERIDVTELL
RESNGPNVLNVTFESTFLLGKKIKEQYPNHHWTCWNGDSSRLAVRKAQYHYGWDWGPTLM
TCGPWRPVDLEIYSARISDLHFRQNVEKSLKQAELVVTAEVEGDAENVTFHIELDGEEKG
AETVDIKDGVATMTFHVQDPQLWYPWRYGNRPLYTLCATVSSNGVKLHSTSKRVGLRRAE
LIQRRMDNTDGTSFFFEINNIPIFCGGSNWIPADNFIPRISRQKYYDWVKLMVDGNQVMV
RVWGGGIFEEQAFYDACDELGLLVWQDFLFGCGNYPAFSSFLENVKREAIANVKILRHHP
SIVILAGNNEDYQFAESEKLKWDPNDNDPISWLKSEFPARYIYEKILVDVTKDLIPDTYY
HYGSPWGGKSTADPTIEISPVECQEKYQDFDKLCGRFISEFGMQGFPDMGTIDGYLTGGI
SDPERHPQSSTVDWHNKAAGHERRLATYLTENIKYNHEPFEQYVYATQLIQAECLSTAYR
LWKRQWKGPAREYCAGALVWQMNDCWPVTSWAIVDYHLRPKPAYYSVKRELAPITISLKR
TSHTEYVDKYTNVYYKTTHKVEVWATNLTAEPRNVNVVLRTWDLITGAETSSEVLKSRFL
LKENRSTEITEFKIPIKGKKGETKDGEEVNRTIVAAYLIENGMQVARYVNWPEPLRYAAL
QVPKKLQVTVSEDGKQVGLSTDLPVKGVVISTDEDTVVFEDNCVDLVPGETVYLGVKGLE
KGQEDKISVRYLGSL

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	5	748	1.1e-94	0.7087765957446809

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	1.22e-73	6	648	12	627	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407658	Mannosidase_ig	8.76e-13	680	777	2	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
395572	Glyco_hydro_2	1.17e-10	195	297	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
236657	PRK10150	5.85e-08	58	324	62	293	beta-D-glucuronidase; Provisional
407625	Ig_mannosidase	3.16e-05	785	850	5	74	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS71278.1|GH2	0.0	1	855	1	860
QSS62028.1|GH2	0.0	1	855	1	860
ATZ49691.1|GH2	0.0	1	855	24	879
CCD56258.2|GH2	0.0	1	855	1	856
APA09815.1|GH2	0.0	1	855	1	856

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	4.70e-125	1	659	21	661	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	1.78e-105	6	852	8	834	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	1.86e-105	6	852	10	836	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	1.90e-105	6	852	10	836	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	4.91e-105	6	852	8	834	Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I2C092|MANBB_THETO	0.0	6	855	6	855	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
sp|A1D911|MANBB_NEOFI	1.14e-259	1	853	1	844	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
sp|Q0CCA0|MANBB_ASPTN	6.91e-258	9	853	9	842	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
sp|Q4WAH4|MANBB_ASPFU	2.10e-257	1	853	1	844	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
sp|B0YBU9|MANBB_ASPFC	2.97e-257	1	853	1	844	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HCEG_05006-t36_1-p1.