CAZyme Information: HCEG_04881-t36_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCEG_04881-t36_1-p1
• CAZy Family: GH37
• CAZyme Description: alpha-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1088	DS990639|CGC2	122900.90	7.1786

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumH88	9666	544711	221	9445

• Gene Location: location=DS990639:1653160-1656696(-)

Full Sequence      

MGGDSRLPSTSSYPTLVHRPVGQKVWSIYKDRLRQFTDGGQYSGQNLVAKYYEATNDDEQ
HVKLSVYSVPNLARPSFKEATANKFKPTKRGESFGPSWSTHWFKIQLTVPEEMRKKERLE
FHWDANNEGMVWTEDGKPLQGLTGGGERIEWILPDSFRDGKEHVFYIEMACNGMFGNAPG
GDSIQPPSPNKYYRLNVARITAVNLQARALYYDFWMIGDAAREFPSDSWHSHQALQVANA
IMDAFIEGNGSQASIVKGRKIAQQYLGNLVDSDKVYKTDKQSIVYGIGHCHIDTCWLWPW
AETRRKVARSWSTQCDLMERYPEHRFVCSQAQQFKWLEKDYPYVFDRVKSFVKKGSFIPI
GGSWVEHDTNMPSGESLARQFIHGQRFFESHFGERCTTFWLPDTFGYSSQIPQLCRLAGM
SRFFTQKLSWNNINKFPHTTFNWVALDGSQVLCHMTPAETYTASAHFGDVRRSVLQHKSM
DQDNTSLLVFGKGDGGGGPTFEHLEKLRRLRGMSDTGELLPRVTMGSSVDDFFAKLEEKA
ANGTNFVTWYGELYFELHRGTYTTQANNKFNNRKSEFVLRDLELLATLATLKDSKYKYPK
KDIDDMWESVLLCQFHDCLPGSSIEMCYDDSDKEYAQIFATGSKLKKEAMKVLGLDSQDS
RADRGLVAINTLPWPRSEIVRVDEGISTSGKTQYALAQGGMGVIAVQPLGSVQTPPVSLN
EVKAGVFRLSNSKVSLEVSKGVITSLVDLAEQREIIARGGKANQLVLFDDKPLYWQAWDV
EVYHLESRKELTSGTTTIAENNPHRVGVVTKTNISDKSWVKTTISLAATTDDSAPIVEIT
CEVEWQETMKFLKVEFPVDITNTEASYETQYGITRRPTHYNTSWDMAKFEVCCHKWADLS
EAGYGVSILNDSKYGFATCGNLMRLSLLRAPKAPDAHADMGRHHIRYAIMPHKGPLDSRT
VRAGYNFNNPLIVQAATGKEDAHLFSAFSLKGSSSLILDTVKRGEDDQDVSRGDFKVRSG
RSIILRIYESLGGKSRGSISSKLPVKQVWKCNLLEDDLEQLEVVQMADAVQVDIELRAFE
VATYRLQL

Enzyme Prediction     

EC	3.2.1.24:32

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH38	284	541	7.8e-86	0.9405204460966543

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223460	AMS1	0.0	91	1088	46	943	Alpha-mannosidase [Carbohydrate transport and metabolism].
212123	GH38N_AMII_ScAms1_like	1.74e-170	284	539	2	258	N-terminal catalytic domain of yeast vacuolar alpha-mannosidases and similar proteins; glycoside hydrolase family 38 (GH38). The family is represented by Saccharomyces cerevisiae alpha-mannosidase (Ams1) and its eukaryotic homologs. Ams1 functions as a second resident vacuolar hydrolase in S. cerevisiae. It aids in recycling macromolecular components of the cell through hydrolysis of terminal, non-reducing alpha-d-mannose residues. Ams1 forms an oligomer in the cytoplasm and retains its oligomeric form during the import process. It utilizes both the Cvt (nutrient-rich conditions) and autophagic (starvation conditions) pathways for biosynthetic delivery to the vacuole. Mutants in either pathway are defective in Ams1 import. Members in this family show high sequence similarity with rat ER/cytosolic alpha-mannosidase Man2C1.
212101	GH38N_AMII_ER_cytosolic	2.78e-117	284	539	2	252	N-terminal catalytic domain of endoplasmic reticulum(ER)/cytosolic class II alpha-mannosidases; glycoside hydrolase family 38 (GH38). The subfamily is represented by Saccharomyces cerevisiae vacuolar alpha-mannosidase Ams1, rat ER/cytosolic alpha-mannosidase Man2C1, and similar proteins. Members in this family share high sequence similarity. None of them have any classical signal sequence or membrane spanning domains, which are typical of sorting or targeting signals. Ams1 functions as a second resident vacuolar hydrolase in S. cerevisiae. It aids in recycling macromolecular components of the cell through hydrolysis of terminal, non-reducing alpha-d-mannose residues. Ams1 utilizes both the cytoplasm to vacuole targeting (Cvt, nutrient-rich conditions) and autophagic (starvation conditions) pathways for biosynthetic delivery to the vacuole. Man2C1is involved in oligosaccharide catabolism in both the ER and cytosol. It can catalyze the cobalt-dependent cleavage of alpha 1,2-, alpha 1,3-, and alpha 1,6-linked mannose residues. Members in this family are retaining glycosyl hydrolases of family GH38 that employs a two-step mechanism involving the formation of a covalent glycosyl-enzyme complex. Two carboxylic acids positioned within the active site act in concert: one as a catalytic nucleophile and the other as a general acid/base catalyst.
212124	GH38N_AMII_Man2C1	1.78e-111	283	539	1	252	N-terminal catalytic domain of mammalian cytosolic alpha-mannosidase Man2C1 and similar proteins; glycoside hydrolase family 38 (GH38). The subfamily corresponds to cytosolic alpha-mannosidase Man2C1 (also known as ER-mannosidase II or neutral/cytosolic mannosidase), mainly found in various vertebrates, and similar proteins. Man2C1 plays an essential role in the catabolism of cytosolic free oligomannosides derived from dolichol intermediates and the degradation of newly synthesized glycoproteins in ER or cytosol. It can catalyze the cleavage of alpha 1,2-, alpha 1,3-, and alpha 1,6-linked mannose residues. Man2C1 is a cobalt-dependent enzyme belonging to alpha-mannosidase class II. It has a neutral pH optimum and is strongly inhitibed by furanose analogs swainsonine (SW) and 1,4-dideoxy-1,4-imino-D-mannitol (DIM), moderately by deoxymannojirimycin (DMM), but not by kifunensine (KIF). DMM and KIF, both pyranose analogs, are normally known to inhibit class I alpha-mannosidase.
395852	Glyco_hydro_38	2.21e-105	284	549	2	270	Glycosyl hydrolases family 38 N-terminal domain. Glycosyl hydrolases are key enzymes of carbohydrate metabolism.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS56318.1|GH38	0.0	1	1088	1	1088
QSS71184.1|GH38	0.0	1	1088	1	1088
QSS62143.1|GH38	0.0	1	1088	1	1088
QVM13608.1|GH38	0.0	1	1088	1	1085
AAW49442.1|GH38	0.0	1	1088	1	1088

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6LZ1_A	0.0	13	1088	4	1077	Structure of S.pombe alpha-mannosidase Ams1 [Schizosaccharomyces pombe 972h-],6LZ1_B Structure of S.pombe alpha-mannosidase Ams1 [Schizosaccharomyces pombe 972h-],6LZ1_C Structure of S.pombe alpha-mannosidase Ams1 [Schizosaccharomyces pombe 972h-],6LZ1_D Structure of S.pombe alpha-mannosidase Ams1 [Schizosaccharomyces pombe 972h-]
7DD9_A	0.0	13	1088	4	1077	Chain A, Alpha-mannosidase,ZZ-type zinc finger-containing protein P35G2.11c,Maltose/maltodextrin-binding periplasmic protein [synthetic construct],7DD9_C Chain C, Alpha-mannosidase,ZZ-type zinc finger-containing protein P35G2.11c,Maltose/maltodextrin-binding periplasmic protein [synthetic construct],7DD9_E Chain E, Alpha-mannosidase,ZZ-type zinc finger-containing protein P35G2.11c,Maltose/maltodextrin-binding periplasmic protein [synthetic construct],7DD9_G Chain G, Alpha-mannosidase,ZZ-type zinc finger-containing protein P35G2.11c,Maltose/maltodextrin-binding periplasmic protein [synthetic construct]
5JM0_A	8.29e-315	16	1086	19	1094	Structure of the S. cerevisiae alpha-mannosidase 1 [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UT61|MAN1_SCHPO	0.0	13	1088	4	1077	Alpha-mannosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ams1 PE=1 SV=1
sp|P22855|MAN1_YEAST	2.77e-314	16	1086	6	1081	Alpha-mannosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AMS1 PE=1 SV=2
sp|Q9NTJ4|MA2C1_HUMAN	4.55e-249	24	1055	8	1004	Alpha-mannosidase 2C1 OS=Homo sapiens OX=9606 GN=MAN2C1 PE=1 SV=1
sp|Q91W89|MA2C1_MOUSE	9.69e-245	24	1055	8	1003	Alpha-mannosidase 2C1 OS=Mus musculus OX=10090 GN=Man2c1 PE=1 SV=1
sp|Q54K67|MANG_DICDI	2.41e-233	31	1085	16	1083	Alpha-mannosidase G OS=Dictyostelium discoideum OX=44689 GN=manG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000018	0.000021

TMHMM  Annotations     

There is no transmembrane helices in HCEG_04881-t36_1-p1.