CAZyme Information: HCEG_04468-t36_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCEG_04468-t36_1-p1
• CAZy Family: GH3
• CAZyme Description: glucose-methanol-choline oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
540		59750.68	5.9973

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumH88	9666	544711	221	9445

• Gene Location: location=DS990638:5253281-5255505(+)

Full Sequence      

MTDTYDFIIVGGGNSGLLLATRLATALPESSVVVLESGSAFPENSHLCQYDRYHAWQRPD
LDLGYITTPQTSLKGQVLPYLRGKGPGGCTNVNFLTYTRGSAEDYNYWAELVGDDSWKWE
HTLRRFKEIETFHAELSEDMKKYSNPLPENHGYNGCLPLNMDTNSGNPIGLSIPPTTTFK
GYRWTSESIYTNYRPANLKMLTDIKVAKVVFENKVAVGIQAVDGRKFTANKEVILSAGVF
DSSKILLLSGIGPTQELSQHNIQTIHDLPGVGKGLSDHPLVVIGASFAPGVGLSDRAQFD
SNPAALEAAREQWKRDGTGEMNLHRSCVITGWLKENSILTTSEYHNLDTLSKQYLTKDSV
PHYELFLAGPHFPPTYAVPEGTSYLSTVVCLMNMQSTGEITLKSANVNDPPVIDPKYMSH
PFDRKMLTLAIREAMKFYQSGAIEKEFKGYVLAPKSQSDEDIHEFIDENLLPVFHANGTL
KMGKADDPMACTDPSFRVYGVEKLRVVDLSVCPITPNQPTAYLVAQTAAEKIIAEYGGRR

Enzyme Prediction     

No EC number prediction in HCEG_04468-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	4	534	2.3e-129	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	5.52e-84	1	532	2	531	choline dehydrogenase; Validated
225186	BetA	1.06e-76	1	540	4	541	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
215420	PLN02785	3.51e-33	4	539	55	583	Protein HOTHEAD
398739	GMC_oxred_C	1.23e-29	395	528	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.41e-26	71	279	12	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS48722.1|AA3_2	0.0	1	540	1	567
QSS73506.1|AA3_2	0.0	1	540	1	567
QSZ30159.1|AA3_2	2.76e-133	3	536	7	585
QRC97674.1|AA3_2	4.36e-129	1	537	1	564
QDS72994.1|AA3_2	4.25e-128	5	537	3	557

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	2.09e-54	5	535	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	2.95e-54	5	535	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	1.07e-47	5	536	41	601	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
5ZU2_A	6.99e-47	5	536	7	573	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	6.99e-47	5	536	7	573	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B8A1|PKFF_EMENI	7.00e-64	4	532	40	607	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|Q9WWW2|ALKJ_PSEPU	3.21e-59	5	533	2	528	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|A0A075TRK9|PATE_PENEN	3.56e-59	3	538	50	626	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|A1CFL2|PATE_ASPCL	1.76e-56	3	538	49	626	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|Q00593|ALKJ_PSEOL	1.88e-56	5	533	2	528	Alcohol dehydrogenase [acceptor] OS=Pseudomonas oleovorans OX=301 GN=alkJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HCEG_04468-t36_1-p1.