CAZyme Information: HCEG_03541-t36_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCEG_03541-t36_1-p1
• CAZy Family: GH17
• CAZyme Description: endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343	DS990638|CGC9	33867.08	4.4501

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumH88	9666	544711	221	9445

• Gene Location: location=DS990638:992992-994099(-)

Full Sequence      

MHSLSLLYLIAAAGSALGHIEMSEPVPFRSRFGSGGDVDYSMTSPLLADGSNFPCKGYQH
DSVSKPSATYKAGGSGEIKLAGTATHGGGSCQISLSYDQGKTFKVIESIIGGCPLPMQYS
FKIPSSAPSGEALLAWTWFNKIGNREMYMNCAPVSIEGGSGDKAAFDKLPDIYVANVGNG
KTTIEGQDVVFPNPGDDTTGTDKSSGDAPAGSSAAGNASAPAAASGAASTPDASPAASPT
PAANTPAANTSAANTPAANTPAANTPAANTSAANTPAANSPAANTPAATTPALQINANAA
SSAAETPSPSESAPASESTPSDASSGIGGSDNLRITCNCSSLP

Enzyme Prediction     

No EC number prediction in HCEG_03541-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA11	19	201	2.3e-71	0.9685863874345549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185594	PTZ00395	2.32e-08	230	330	417	517	Sec24-related protein; Provisional
185594	PTZ00395	3.24e-07	233	324	400	478	Sec24-related protein; Provisional
236138	PRK07994	3.70e-07	231	325	361	454	DNA polymerase III subunits gamma and tau; Validated
223021	PHA03247	4.00e-07	230	329	2770	2860	large tegument protein UL36; Provisional
223021	PHA03247	5.02e-07	230	330	2755	2855	large tegument protein UL36; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS55105.1|AA11	1.73e-163	1	343	1	343
QSS73131.1|AA11	2.53e-158	1	343	1	323
QSS65347.1|AA11	2.88e-158	1	343	1	307
QVM11324.1|AA11	5.87e-74	15	197	12	197
QMW48536.1|AA11	1.79e-69	10	196	11	199

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAH_A	6.77e-39	19	195	1	196	Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Zn [Aspergillus oryzae],4MAI_A Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Cu(I) [Aspergillus oryzae]

Swiss-Prot Hits     

HCEG_03541-t36_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000268	0.999688	CS pos: 18-19. Pr: 0.9736

TMHMM  Annotations     

There is no transmembrane helices in HCEG_03541-t36_1-p1.