CAZyme Information: HCEG_03037-t36_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCEG_03037-t36_1-p1
• CAZy Family: GH13|GH13
• CAZyme Description: DUF1237 domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
882		97852.45	5.8424

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumH88	9666	544711	221	9445

• Gene Location: location=DS990637:4712872-4717470(-)

Full Sequence      

MAANYKKYLAEKVLNEQDIVTHRALSRALKVHSNLAKRVEPTRLQDLNVLGDIGHDIMQP
QPNDPLEYGKQYGMILNRNVKAEHSGPEDVVLDDASEEEREDLFLDTGTRRSNSKRESRK
EREEKLRKMMEDEDMEDVPEDVPELPPARAPERTDTSQSEEVPKAESKEEASAPKGRRRG
RRQVMKKTTIKDAEGYLVTKEEPVWESFSEDEAPPPVKRKPAVSVNSKPTSSNKGSQKTG
QGNIIARITGFEPVPTIFGPKPMLVQRSAVTETRREPQDPRAWNRSARDPGLSRVLGTFA
LSFGQISGCPSTGCAAETPLARGDQAGAIAIALLHVLARDMRALPWTAAVLAALVSNGAL
AGSSHPDDAASLAVACPDYSEYSKLKHPPYSEGPLQLPFQRPVLPCRTFASTFIEKVIED
VTSRMVDKDLAQLFRNAYPNTADTTVRWHVDSSDPRSKILTQYPQSESWQGPQSFIVTGD
INAEWLRDSANQVAGYQMLAAKDPKIKTLILGAINTQVEFVLQSPYCNAFQPPPPSGLLH
TIPQTQSDIVHPAYEQSVVFECKYELDSLANFLAIGNKFFAETKSTEFVTTRWYRAVLTV
LQVIEEQSKPTFDDQGEYVRNTYTFKRLTTLGTETLNLDGVGNPLNNGTGLVRSAFRPSD
DATIFGYFIPANAYLSVELKRTALTIKAAGGPDSLIQTLEQRASIVEKGIRDHGIVSHKK
FGEVYAFEVDGYGSRLLMDDANLPSLLSLPLLGFVDKDDEVYQNTRKMLLTKTGNPYYLT
GTQFHGIGGPHAGLSNAWPMSVLVRARTSDDDEEIMESINMVRNASLLGLIHESVDVDNI
RVYTRSWFAWANSVFAQTILELAERKPYLLFGKGASPYKAGE

Enzyme Prediction     

No EC number prediction in HCEG_03037-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	427	860	3.4e-158	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	427	860	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	1.40e-143	406	870	2	430	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].
370537	CDC27	4.61e-68	19	244	2	420	DNA polymerase subunit Cdc27. This protein forms the C subunit of DNA polymerase delta. It carries the essential residues for binding to the Pol1 subunit of polymerase alpha, from residues 293-332, which are characterized by the motif D--G--VT, referred to as the DPIM motif. The first 160 residues of the protein form the minimal domain for binding to the B subunit, Cdc1, of polymerase delta, the final 10 C-terminal residues, 362-372, being the DNA sliding clamp, PCNA, binding motif.
406410	CARMIL_C	9.34e-06	77	234	85	271	CARMIL C-terminus. This domain is found near to the C-terminus of leucine-rich repeat-containing proteins in the CARMIL family. In leucine-rich repeat-containing protein 16A (LRRC16A) it includes the region responsible for interaction with F-actin-capping protein subunit alpha-2 (CAPZA2).
411407	PspC_subgroup_1	0.001	109	214	386	484	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS49978.1|GH125	0.0	341	882	1	542
QSS68485.1|GH125	0.0	341	882	1	542
QSS59948.1|GH125	0.0	341	882	1	542
QVM13217.1|GH125	9.09e-259	349	882	9	547
QKX57883.1|GH125	9.93e-253	1	871	1	1010

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P0V_A	9.71e-88	401	862	43	468	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3ON6_A	2.41e-85	401	862	23	448	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
3P2C_A	9.91e-83	401	862	21	450	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
6RQK_A	2.35e-73	414	861	12	421	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]
3QT3_A	2.62e-73	414	861	12	421	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	2.19e-175	375	870	26	504	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1
sp|P30261|DPOD3_SCHPO	1.20e-07	156	238	273	352	DNA polymerase delta subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc27 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000070	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HCEG_03037-t36_1-p1.