CAZyme Information: HCEG_02673-t36_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCEG_02673-t36_1-p1
• CAZy Family: GH13
• CAZyme Description: glucose-methanol-choline oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
604	DS990637|CGC6	65034.52	5.2110

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumH88	9666	544711	221	9445

• Gene Location: location=DS990637:3295938-3297831(+)

Full Sequence      

MSTTQIPTAADYVIVGGGTAGLVLAARLSEDPGTSVVVLEAGTNHLEDPRVNIPALWTTL
FGTDADWAFATVPQVTLGDRTINAAQGKMLGGSSGINGQAFVSASELVIDAWSKLGNEGW
TWKNLHPYYKKSYTLNLPDDETCEHLGLNWVEPSAHGSSGPIQVSFPGQLQNPLVKAWVE
LFKSIGYDVTADPYSGASTGGFSSLAAVDPQTKTRSYSANTYGIAAMQRPGVRIVTDAFV
KKVLLEGSKPDVHATGVEVDVKGQLVTVGANKEVIITAGALNTPKLLELSGIGNKKILQK
YNIPVVVDNPNVGENLQDHLMSGISFEVVDGVVTGDPLLRQEPEATQSAMQMYSEHKAGP
MTIGGVQSSALMPILEFAGVGGQESQTRFFDKYLPTASAFQSTVRDIFETHKAPTCDMFM
FLAQANLHEANTSCFVGTRLLPGNYLSLGVMQSIPFSRGHTHISSANPEDKQTIDPRYFS
HPLDIEILAQNLLDVERLHENEALTKYLKKPNGRRNHSDSFLTDVESAKKYLRDTVTTAY
HFSGTASMLPEDQGGVVNENLVVHGTLNLRVCDASIFPVIPPANLMATVYAVAERAADII
KTDA

Enzyme Prediction     

No EC number prediction in HCEG_02673-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	10	602	3.7e-176	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.14e-114	10	601	6	532	choline dehydrogenase; Validated
225186	BetA	9.12e-100	10	604	8	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	5.56e-56	10	600	1	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	1.06e-33	455	596	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	4.36e-33	76	320	13	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS49637.1|AA3_2	0.0	1	604	1	604
QSS68114.1|AA3_2	0.0	1	604	1	604
QSS60310.1|AA3_2	0.0	1	604	1	604
CAK46356.1|AA3_2	5.19e-265	2	603	3	601
BCS02826.1|AA3_2	2.43e-263	2	601	3	599

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	5.54e-82	8	604	4	568	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	7.83e-69	12	603	8	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	1.18e-63	11	603	3	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.68e-62	11	603	4	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
3Q9T_A	2.06e-60	11	603	8	572	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A161CEV4|CITC_MONRU	2.26e-99	6	603	10	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	2.26e-99	6	603	10	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	3.59e-97	6	603	10	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|M5EAX2|GMCH_MALS4	1.41e-84	11	600	48	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.41e-84	11	600	48	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999173	0.000863

TMHMM  Annotations     

There is no transmembrane helices in HCEG_02673-t36_1-p1.