CAZyme Information: HCEG_02398-t36_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCEG_02398-t36_1-p1
• CAZy Family: CE4
• CAZyme Description: glucoamylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1313		144998.09	6.5688

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumH88	9666	544711	221	9445

• Gene Location: location=DS990637:2479370-2484677(-)

Full Sequence      

MDYVMPLTKALLANIGAEGAKVKGAVAGIVVASPSKEDPDYFYTWTRDASLVFKGLVDAF
ISGDTSLQSKIHEFISAQAHLQTISNPSGGLSSGGLGEPKFDVNMSSFNGNWGRPQRDGP
ALRATAMISYGKWLIANGYANTARMIVWPVVQNDLSYVAQFWSSPGFDLWEEVDGMSFFT
TAVQHRALVEGSRFARQIGLRCPSCESQAPQVLCFMQNYWTGSYINSNTGGDRSGKDTNS
ILASIHTFDPEASCDDLTFQPCSAKSLANHKVVTDSFRSIYPLNHGVSAGSAVAVGRYPE
DVYFGGNPWYLSTFAAAEQLYDAIYQWQRLGSILVTDVSIHFFKDIYASAVVGTYPSSST
TFKSIIEAVRDYADGYLAVAQKYTPVSGELAEQFSRDDGTPLSASDLTWSYASFLTAVSR
RNSSVPDPWGQTAASSIPSTCQITSATGPYRTATNTKWPSDLTSISRTTSFSNGLTETKI
TTTSTTTSTSPCVTPDSIRVTFNEVATTTPGQRIFIIGSVPELGSWDVLSAIALSADQYT
DDNRLWHRTIQLGAGLDFEYKYIRLSMRTEANAIMQKPACLRISCFCEKHSSQMPHRMSW
SAVSTPFQKWEILCHKWMMLPVPMSWAKHSVTAFSVPKCRPLRGCLEHETEVSPPTRRLL
ILALQDDKARCIHFSRIAWRLVDIASVNYLQTTMSFSDSLPVSDTSQELFGSAEWLLSPP
AFVAQKGDHGPAQVTFPPPGAESETGFRTRQRVSLACLPCRNRHVKCDSGLPICSRCKFD
GRQCKYMQSRRGGHNKIVSSDTRAPVTQSPTRGSEFSHRSSGDRTSTRVGDSDSAGMVET
GTSSESAATTGSASLDRPFECYYTFFHESHPMVLPKQHFTARLDVDPESLEVVAAIMRYI
GSLYGHCPSPEFFKSLSESLLFCNQLPRNGFSVQALMLYSIATHWNNDKPRAREILDVAT
TMALEIGMNSCQFAYQHGEGNLVLEETWRRTWWLLYIVDSLYAGIRHSPGFALWSVNSNV
DLPCEEEDFHSGNIPKPKTLVEFDDRQFDTVDVVFSSFAYLIDASRILGTTLAVGLDDSN
PVDPEVDYADSGLVAWSLHLPDIKRELVTNKGNVDPILFLAHMLIHTTTIYLHRPRSKLL
YNNAENISKCAPPPPPERLTHAAQEAYQMHTVKVLTASEKISSLLALPTPLVKQSQFIIC
MVALSTIAQLSACIFDTNIDTSRAIKERIRLNIGALKAHEKIWPLGRKTLYEVKLIARQV
FALPNLDCQAISDLMDQAHEISNHSGNSVMIDESFPTAIFGDSCFLSPVPPPL

Enzyme Prediction     

EC	3.2.1.3:94	1.14.99.55:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH15	12	418	9.9e-78	0.9833795013850416
CBM20	498	567	6.5e-17	0.7222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395586	Glyco_hydro_15	3.00e-133	9	417	5	415	Glycosyl hydrolases family 15. In higher organisms this family is represented by phosphorylase kinase subunits.
99886	CBM20_glucoamylase	6.43e-35	492	564	1	73	Glucoamylase (glucan1,4-alpha-glucosidase), C-terminal CBM20 (carbohydrate-binding module, family 20) domain. Glucoamylases are inverting, exo-acting starch hydrolases that hydrolyze starch and related polysaccharides by releasing the nonreducing end glucose. They are mainly active on alpha-1,4-glycosidic bonds but also have some activity towards 1,6-glycosidic bonds occurring in natural oligosaccharides. The ability of glucoamylases to cleave 1-6-glycosidic binds is called "debranching activity" and is of importance in industrial applications, where complete degradation of starch to glucose is needed. Most glucoamylases are multidomain proteins containing an N-terminal catalytic domain, a C-terminal CBM20 domain, and a highly O-glycosylated linker region that connects the two. The CBM20 domain is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. laforin). CBM20 folds as an antiparallel beta-barrel structure with two starch binding sites. These two sites are thought to differ functionally with site 1 acting as the initial starch recognition site and site 2 involved in the specific recognition of appropriate regions of starch.
213391	fungal_TF_MHR	4.03e-33	859	1253	10	401	fungal transcription factor regulatory middle homology region. This domain is present in the large family of fungal zinc cluster transcription factors that contain an N-terminal GAL4-like C6 zinc binuclear cluster DNA-binding domain. Examples of members of this large fungal group are the following Saccharomyces cerevisiae transcription factors, GAL4, STB5, DAL81, CAT8, RDR1, HAL9, PUT3, PPR1, ASG1, RSF2, PIP2, as well as the C-terminal domain of the Cep3, a subunit of the yeast centromere-binding factor 3. It has been suggested that this region plays a regulatory role.
395557	CBM_20	4.44e-24	498	566	1	68	Starch binding domain.
99883	CBM20_alpha_amylase	1.38e-18	500	564	3	63	Alpha-amylase, C-terminal CBM20 (carbohydrate-binding module, family 20) domain. This domain is found in several bacterial and fungal alpha-amylases including the maltopentaose-forming amylases (G5-amylases). Most alpha-amylases have, in addition to the C-terminal CBM20 domain, an N-terminal catalytic domain belonging to glycosyl hydrolase family 13, which hydrolyzes internal alpha-1,4-glucosidic bonds in starch and related saccharides, yielding maltotriose and maltose. Two types of soluble substrates are used by alpha-amylases including long substrates (e.g. amylose) and short substrates (e.g. maltodextrins or maltooligosaccharides). The CBM20 domain is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. laforin). CBM20 folds as an antiparallel beta-barrel structure with two starch binding sites. These two sites are thought to differ functionally with site 1 acting as the initial starch recognition site and site 2 involved in the specific recognition of appropriate regions of starch.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS49369.1|CBM20|GH15	0.0	9	564	56	611
QSS67842.1|CBM20|GH15	0.0	9	564	56	611
QSS60609.1|CBM20|GH15	3.36e-310	9	564	99	582
CAC28076.1|CBM20|GH15|3.2.1.3	6.46e-248	11	564	47	583
ABH92242.1|CBM20|GH15|3.2.1.3	6.46e-248	11	564	47	583

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FRV_A	3.48e-222	10	565	17	582	Structure of the catalytic domain of Aspergillus niger Glucoamylase [Aspergillus niger]
1AGM_A	3.56e-208	10	460	17	467	Refined structure for the complex of acarbose with glucoamylase from Aspergillus awamori var. x100 to 2.4 angstroms resolution [Aspergillus awamori],1DOG_A REFINED STRUCTURE FOR THE COMPLEX OF 1-DEOXYNOJIRIMYCIN WITH GLUCOAMYLASE FROM (ASPERGILLUS AWAMORI) VAR. X100 TO 2.4 ANGSTROMS RESOLUTION [Aspergillus awamori],1GLM_A REFINED CRYSTAL STRUCTURES OF GLUCOAMYLASE FROM ASPERGILLUS AWAMORI VAR. X100 [Aspergillus awamori],3GLY_A REFINED CRYSTAL STRUCTURES OF GLUCOAMYLASE FROM ASPERGILLUS AWAMORI VAR. X100 [Aspergillus awamori]
1GAH_A	3.69e-208	10	460	17	467	GLUCOAMYLASE-471 COMPLEXED WITH ACARBOSE [Aspergillus awamori]
1GAI_A	3.83e-208	10	460	17	467	GLUCOAMYLASE-471 COMPLEXED WITH D-GLUCO-DIHYDROACARBOSE [Aspergillus awamori]
3EQA_A	6.12e-206	10	460	17	468	Catalytic domain of glucoamylase from aspergillus niger complexed with tris and glycerol [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36914|AMYG_ASPOR	8.88e-237	9	565	43	579	Glucoamylase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=glaA PE=2 SV=2
sp|P0DN29|AMYG_ARTBC	2.18e-227	9	564	40	576	Glucoamylase ARB_02327-1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02327-1 PE=1 SV=1
sp|P22832|AMYG_ASPUS	2.38e-226	10	565	41	605	Glucoamylase OS=Aspergillus usamii OX=186680 GN=glaA PE=3 SV=1
sp|P23176|AMYG_ASPKA	2.30e-223	10	565	41	605	Glucoamylase I OS=Aspergillus kawachii OX=1069201 GN=gaI PE=1 SV=1
sp|P69327|AMYG_ASPAW	4.12e-221	10	565	41	606	Glucoamylase OS=Aspergillus awamori OX=105351 GN=GLAA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000040	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HCEG_02398-t36_1-p1.