CAZyme Information: HCEG_01710-t36_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCEG_01710-t36_1-p1
• CAZy Family: AA7
• CAZyme Description: UDP-glucose:glycoprotein glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1631		182714.56	5.8733

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumH88	9666	544711	221	9445

• Gene Location: location=DS990636:6553368-6561037(-)

Full Sequence      

MDPGKQFGSALPWAEPAWYSGRPSPYYNKSHFKLRDAVRKWTEETVGAPPIRQFASKWLQ
KKILPEILSGQKRICLAVTEPSCGSDTAVRTGGPGADGISFLLIPRTEGIRTRKIEIGAD
GLSATTYIIFEDVKVPVEYLIGSEGQGFRYVMSNFNHERLWIAFQALRNARTCLQDAMAW
AMKREAFDMKLIDQPVVRYKFGSMAKEVEALQAWTEQIVYELDHMSYQDGNRQLGGVTAL
LKVKGGQMNKFVADNCVQIMGGLGLTKTGQGSRIEAISRSTHSLIVPGGSEDVLIDLGVR
EALKLSAAKKRWFETHQYQISLGKTTINIASSIPSNKDSKVCGEGTKLRPTYYDSFIRQT
TLPLNVALQTSFNAAPYLVELLHDRVLPFDRVFGDPSLPPLILYADVESPLFGGFHHQLM
QQARDGQFSYRVRYRPASSATSRPLFVNGYGVELALKRTDYIVIDDRDAEQRVLKDTDTT
NPTLAPAEDLENEQPADLKPLSASEVSTLGMNAASFIMSSDDPFATLLRLSQDFPRHSSA
IAGASRTSEFTQEFEQNKDNHLQTGRNVIWVNGLQMEAQTVDAFSLLDHLRRERKLINDL
RKFGLSARQAVDLLTNPTISKSLGTDDSIRYDYRDDLEGGGVIVWLNDLEKDHRYEGWPR
DLHSSLSADKIGSPDQASFTAALGNHELRKDRTPLTFEDVLRSDNYDPIVSNTKSYLKRL
AVKGDILPFFVNGATLMREGNFLQNMITALSKDLEHLQRRVYEGAFEEDIWIPSHFLQEA
LQNRSPLLIPENPSEIQITDLNEIYANHLNVFDTILRIPASVESDDPLLDWNSIILIADL
DSGAGAELLSSLLELHKKHPGVEILLLHNGESPSTPEALSTRLYSIRKGRDLDPAVVTAA
LASRNDDSASDSAAASAYWNTVQFLVKEIGFGTREIGMVVNSRILGPLPSSTILDTEDLE
NLLMYEHSKRIGVLARVASEMDLDSNILDSLSLSRMQAILSLSVTSGISESIYNYGPSAR
TRVFEKWSGIHTAISVSNSDDPSINIVATIDPTTEEAQRWVPILKVLSELGGVSLKLFLN
PREEIKELPIKRFYRHVLDVAPSFNEDGSLAKPQAVFHGIPGEALLNLGMDVPPAWLVAP
KESIHDLDNLKLSTLRAGTNVDAIYELEHILIEGHSRDITQGGPPRGVQLLLGTEKSPHF
ADTIIMANLGYFQFKAQPGCWKITLKPGQSERIFHIDSVGGLGSKPTPGDESNDVALLSF
QGKTLFPRISRKPGYENEDVLDEVNKPATAAKDFLAKGLNFASEILHRLAGPAQGTHADI
NIFSVASGHLYERMLNIMMVSVMKHTKHSVKFWFIEQFLSPSFKSFLPHLAAEYGFSYEM
VTYKWPHWLRAQTEKQRIIWGYKILFLDVLFPLSLDKVIFVDADQIVRTDMYELVTLDLE
GAPYGFTPMCDSRTSMEGFRFWKQGYWKNFLRGLPYHISALYVVDLKRFRAIAAGDRLRG
QYHTLSADPQSLSNLDQDLPNNMQRMLPIKSLPQDWLWCETWCSDESLATAKTIDLCNNP
LTKEPKLDRARRQVHEWTVYDEEIAAVQRRVLEEEKERMGAVIEGVDEEVPRNEGGDHGD
GKNKKHKKDEL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1320	1567	4.6e-134	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	0.0	1320	1587	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	0.0	1320	1567	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
399437	UDP-g_GGTase	2.88e-61	1173	1282	1	109	UDP-glucose:Glycoprotein Glucosyltransferase. UDP-g_GGTase is an important, central component of the QC system in the ER for checking that glycoproteins are folded correctly. This QC prevents incorrectly folded glycoproteins from leaving the ER.
132996	Glyco_transf_8	7.88e-60	1320	1567	1	246	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
408200	Thioredoxin_13	2.22e-53	493	626	1	134	Thioredoxin-like domain. This is the second out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS51253.1|GT24	0.0	383	1631	171	1506
QSS69256.1|GT24	0.0	383	1631	171	1507
QSS63494.1|GT24	0.0	383	1631	182	1518
CAK39488.1|GT24	0.0	385	1617	171	1491
CAS97678.1|GT24	0.0	385	1617	171	1491

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NV4_A	0.0	385	1594	148	1454	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	0.0	385	1594	148	1454	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5MU1_A	0.0	385	1594	148	1454	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	0.0	385	1594	148	1220	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	0.0	385	1529	141	1382	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	1.35e-248	375	1587	142	1424	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q6P5E4|UGGG1_MOUSE	6.77e-212	395	1588	190	1524	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9NYU2|UGGG1_HUMAN	2.81e-211	395	1597	190	1532	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q9JLA3|UGGG1_RAT	4.99e-211	395	1588	190	1524	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2
sp|Q09332|UGGG_DROME	2.09e-202	389	1595	172	1515	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000074	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HCEG_01710-t36_1-p1.