CAZyme Information: HCEG_00407-t36_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCEG_00407-t36_1-p1
• CAZy Family: AA11
• CAZyme Description: capsule-associated protein CAP1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
618	DS990636|CGC8	71159.55	8.3079

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumH88	9666	544711	221	9445

• Gene Location: location=DS990636:1255802-1257738(-)

Full Sequence      

MRTQRLVVLLAIVCLVGLSLTLLGHPAAAVKSGNKGKVLTNNRFEPAKQQERPQPHQHQQ
QQNSPHERPITADDLTGPSHPIAELFDDANRKFDDVRARQSKTLKDAVEEYRRRYKMPPP
PNFDVWFDFAQKRDVQLIDEFDTIYHSLLPFWGLQPKLIRARAMEVIGFDNGVIAILIRD
GKVSKITGGDEGETWKRNALQNMLEPFVKYLPDMDLAFNLHDEPRVVVPHDDLQRLVVRA
VDNALPKALGNASPKNSWSPRPKDMNKGDRVDEVRITQFNRYAHQPTWIVSRMSCPVDSP
ARNLDGTAADNITSYSYSKLGFLSNSTAFSDICLSPSLQYTFGFFDRPNAFNVVHDLFPI
FSQSKVSSFQDIIYPSPWYWAQKVPYDAAKDIEWDKKKEQMYWRGSTTGGFSRAGSWRRQ
HRQLFVKRINGQDSAKVLERSITPSGKNAWVLKDVARQKFKDIFNVKFSHIGQCDPEDCK
VQAEFFDVVEPASQHDAWNYKHLLDIDGNAFSGRYYAFMQSNSLVYKLALFREWHDERLR
AWVHYVPLSLRGDEHVEAVRYLAMEKEGQEIAQKLANQGKEWASSVLRNDDLEVYFFRLL
LEYGRIVDDNRESIGFSP

Enzyme Prediction     

No EC number prediction in HCEG_00407-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	336	607	6.2e-81	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	7.46e-16	355	605	28	251	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.25e-08	359	605	108	321	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS52524.1|GT90	0.0	1	618	1	618
QSS70518.1|GT90	0.0	1	618	7	624
QSS64625.1|GT90	0.0	1	618	131	743
BCR83603.1|GT90	3.85e-275	79	616	65	598
QGA13289.1|GT90	1.37e-270	56	618	26	590

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	2.42e-09	336	610	95	345	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	2.79e-08	359	607	154	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.31e-52	77	613	149	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|B0X1Q4|RUMI_CULQU	7.11e-12	352	607	157	389	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q16QY8|RUMI_AEDAE	2.08e-09	359	607	163	388	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|G3V9D0|PGLT1_RAT	6.21e-09	336	610	123	373	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	1.45e-08	336	610	123	373	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.143762	0.856192	CS pos: 29-30. Pr: 0.7822

TMHMM  Annotations     

Start	End
7	29