CAZyme Information: HCDG_09455-t38_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCDG_09455-t38_1-p1
• CAZy Family: GT76
• CAZyme Description: BKRF1 encodes EBNA-1 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
301	GG692441|CGC1	32801.77	9.7779

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumH143	9796	544712	249	9547

• Gene Location: location=GG692441:174894-176088(+)

Full Sequence      

MFSSCSYFYKVPQDQLSRPSPESFRSKAIAGGSNLRILPLGDSITYGQGSSDGNGYRLPL
YDLLSRWNKVEYIGRERHGSMSNNRHEGHKGFPIGAVGNTGKLDYVERPNIVLLLAGTND
VVFKINLKTAPEVLGRVVDDIVSACPDAVVLVATIPPLLDRNREAQRVAFNAALPAVMEQ
RKEAGKHVLLVDLATVTTRHINATDGIHPVDEGYRLIADAWYKSIVHADQKGWIKAPVAK
PANGEVDRIKPTIQAMPIVPGRPIVAGRPIVAGTSAGFWSPFRMLAALVVVSVGCFWALR
N

Enzyme Prediction     

No EC number prediction in HCDG_09455-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	35	225	3.5e-47	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	2.22e-44	35	225	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	7.84e-19	40	216	2	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	1.65e-16	37	223	1	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
239945	SGNH_hydrolase_like_4	1.11e-09	36	225	2	183	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238870	SGNH_hydrolase_like_1	1.22e-09	36	220	1	181	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. Myxobacterial members of this subfamily have been reported to be involved in adventurous gliding motility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS51733.1|CE3	3.51e-197	1	300	1	324
APA11680.1|CE3	3.21e-51	30	239	50	259
QIW95188.1|CE3	5.09e-49	27	241	35	248
VDB86298.1|CE3	2.56e-47	34	246	72	285
CCD55162.2|CE3	2.17e-46	34	239	50	255

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VPT_A	4.08e-23	35	223	6	193	Chain A, LIPOLYTIC ENZYME [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9RLB8|CESA_RUMFL	7.46e-12	21	236	32	266	Multidomain esterase OS=Ruminococcus flavefaciens OX=1265 GN=cesA PE=1 SV=1
sp|P15329|GUNX_ACETH	1.09e-07	107	223	24	135	Putative endoglucanase X (Fragment) OS=Acetivibrio thermocellus OX=1515 GN=celX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000071	0.000001

TMHMM  Annotations     

Start	End
277	299