CAZyme Information: HCDG_08903-t38_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCDG_08903-t38_1-p1
• CAZy Family: GT66
• CAZyme Description: choline dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
567		61937.47	8.9988

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumH143	9796	544712	249	9547

• Gene Location: location=GG692435:715017-717189(-)

Full Sequence      

MLLSFLPSGSRARTLCYALILFASFATSSVLVRDGDKQSLRDRNEFDYIIVGGGLTGLVA
AHRLSENLFGMAYDRASAADYDSWEALGNRGWGWKGMFPYFRKSADFTPPKKAVVNKYGY
TYDESAYGRFGPLQVTFPDWQVPDQYKMADAFTELGVAHLREHAMGNAVGQFWAPATIDA
KTMTRSSSLTAYYDKASWRPNLKMLTEHKVTQLAFKGASTTVSGVKAINRKTNKEVTFRA
SKEVILAAGSLHTPQILQLSGIGPKCVVEAAGIKSRVDLPGVGSNLQDHPVAYLNWKVTN
SFPEPNIMTTNETFAAEALAEYQAHRTGPYTKAQSNTIAFLSLPMVTNNTEDMINSLKQQ
VASKYLPGVYSRELIAGYEAQRAILAKQLGEGSVSALEFPFGGSGMVPNSVQKPLSRGTV
HLNPDDPHGEPIVTYNAFTNPFDRAQLASFIAFTRRYFKTNALADMQPQEVSPGEDAQTE
DEIIAKLAAGGPLSLSPSFAHPSSSCPMMPKNKGGCVGADLRVHGTRKLSIIDASILPII
PSAHLQATMYAVAEKASDIIKWRSFWP

Enzyme Prediction     

No EC number prediction in HCDG_08903-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	70	561	1.9e-138	0.8362676056338029

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	5.29e-58	44	564	4	535	choline dehydrogenase; Validated
225186	BetA	4.32e-54	44	564	6	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	3.61e-35	414	556	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	7.61e-25	46	291	1	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	7.56e-11	1	549	11	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS75262.1|AA3_2	0.0	71	567	1	497
QSS59059.1|AA3_2	2.06e-285	148	558	1	411
QDS77604.1|AA3_2	1.94e-183	41	564	24	614
QRC90410.1|AA3_2	2.35e-143	45	563	29	614
QRC99164.1|AA3_2	7.50e-142	14	564	3	623

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6O9N_A	3.12e-99	15	560	4	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
6ZE2_A	1.21e-94	50	561	83	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4YNT_A	2.15e-55	46	561	6	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6XUT_A	2.37e-45	46	561	17	588	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]
5OC1_A	3.91e-44	65	561	86	562	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	1.64e-89	11	566	11	619	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|M5EAX2|GMCH_MALS4	5.57e-62	22	560	24	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	5.57e-62	22	560	24	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|P0DO29|ERIK_HERER	2.57e-55	18	561	9	596	Dehydrogenase eriK OS=Hericium erinaceus OX=91752 GN=eriK PE=3 SV=1
sp|A0A142PTM2|CITC_MONPU	6.30e-52	71	561	104	609	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.752661	0.247334

TMHMM  Annotations     

There is no transmembrane helices in HCDG_08903-t38_1-p1.