CAZyme Information: HCDG_08480-t38_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCDG_08480-t38_1-p1
• CAZy Family: GT58
• CAZyme Description: DUF821 domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410		46442.21	9.2935

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumH143	9796	544712	249	9547

• Gene Location: location=GG692436:209389-210845(+)

Full Sequence      

MILLGLSGRYFTFVAITILLITAILYGSFSHVYSGPLSYLPKSQSQLPLCRAPSPAAGSD
NNNSNDGACVGVKPWKFETTRDGDNYGLSRAQCQQAFPKLYIEIEKAVAARRGRNITFDE
LNSKPLKNSMVRAMIYQGALYVLNFEDMRYTFSRAKASLNALNRALNAIPNRYEIPNIEF
IFTTEDYHDDPHPIWVYSKRETNGWAWLMPDFGYWSWPEIKAGQYRSIRQRIAAIDEGAI
INGKPCTALRFQRKKKQLLWRGAIATAPALRQKLLDVTKGKSWASVRALNWADETSMRDD
YIPIEDHCKYMFLAHVEGRSYSGRGKYLQNCRSVIVAHQLVWREAHHGALVATGPEANYV
KVRRDFSDLEAKMNYLLDNPEVAEKIAENGVPCAICGCKWRAEFGARCAV

Enzyme Prediction     

No EC number prediction in HCDG_08480-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	176	390	6.2e-24	0.868

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
310354	Glyco_transf_90	6.31e-18	175	390	79	295	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.
214773	CAP10	4.53e-12	174	390	1	225	Putative lipopolysaccharide-modifying enzyme.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS70846.1|GT0	1.25e-288	1	391	1	391
QSS64975.1|GT0	6.32e-282	1	391	1	391
BCS13796.1|GT0	3.00e-137	75	391	68	385
BCS02108.1|GT0	3.00e-137	75	391	68	385
UDD61446.1|GT0	8.55e-136	68	391	57	381

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	6.76e-10	175	390	94	314	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0X1Q4|RUMI_CULQU	9.83e-10	59	390	15	361	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q16QY8|RUMI_AEDAE	2.31e-09	124	390	84	360	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	3.97e-09	175	390	122	342	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|Q5E9Q1|PGLT1_BOVIN	5.29e-09	175	390	122	342	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1
sp|G3V9D0|PGLT1_RAT	5.20e-08	175	390	122	342	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999763	0.000257

TMHMM  Annotations     

Start	End
7	29