CAZyme Information: HCDG_08050-t38_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCDG_08050-t38_1-p1
• CAZy Family: GT4
• CAZyme Description: FAD binding protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
554		60121.48	5.9053

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumH143	9796	544712	249	9547

• Gene Location: location=GG692433:174486-176939(-)

Full Sequence      

MILAGTLLSCAALYLCSVSAKATPLDCKCGPGDACWPSAREWQALNSTIDGKLIRAIPPA
SVCYKSQPTYDAAACSSILAQWHTSGFHLQDPISIDFPMWAGDSCPPIFENGTSVNGDPT
AGKKGCSIGRHPVYVVNATGPEEVVTAVKWAGERNIRVNVKATGHSLTGRSTAEGSLSIW
TRNIRSIKFHPKFQSASCPGGESGRQAQMAATVGAGEIGYDVIQELDKYGATAVTGGNNY
VGLVGWLTGGGHGRLSSSYGMGSDNLIEANIITPTGKFLTVNACQHTDLFWAIRGGGGGT
YGIITSVIIKAYPTPSTTVWKIQGQLLDKSKEDQWWDLMAYFYSLLPSMKQEGLQGYYRM
IGQPFADTLVFVASFLLYDKPNGTAEALFEPFKQRLDELMRAKSVAYLSEIFTEPSFLKG
YDRLVSDEPVAHVDYALGTWLLPAQPMEDVEVMAKMFKEIGPKIGGNSMDPFDPDWQNVA
FGPNYKKLRAIKQKYDPDALLWCFSCVGSEDWVEIEDGRLCRAYGGICPALTRNIIERSV
CAVEGSGGMNTFNL

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	128	322	1.8e-49	0.3930131004366812

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	3.79e-23	132	282	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	1.60e-14	132	280	32	168	FAD/FMN-containing dehydrogenase [Energy production and conversion].
369658	BBE	1.18e-07	467	502	4	39	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
215242	PLN02441	1.08e-04	92	293	20	221	cytokinin dehydrogenase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57322.1|GH43_11	1.31e-65	17	522	491	1065
QKD57322.1|CBM91|GH43_11	1.31e-65	17	522	491	1065
UQC87672.1|AA7	1.77e-16	132	320	70	243
UNI23960.1|AA7	1.54e-14	132	319	48	222
UJO20529.1|AA7	9.77e-14	132	501	90	508

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F72_A	2.09e-70	26	523	27	574	Crystal structure of VAO-type flavoprotein MtVAO615 at pH 7.5 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_A Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_B Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6F74_A	5.56e-62	20	522	24	597	Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_B Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_C Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_D Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6FYD_A	6.62e-22	127	500	40	452	The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_B The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_C The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_D The crystal structure of EncM T139V mutant [Streptomyces maritimus]
6FYB_A	1.59e-21	127	500	40	452	The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYB_B The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYB_C The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYB_D The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYC_A The crystal structure of EncM L144M mutant complex with dioxygen under 15 bars O2 pressure [Streptomyces maritimus],6FYC_B The crystal structure of EncM L144M mutant complex with dioxygen under 15 bars O2 pressure [Streptomyces maritimus]
6FYG_A	1.59e-21	127	500	40	452	The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_B The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_C The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_D The crystal structure of EncM V135T mutant [Streptomyces maritimus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|S0DL65|APF9_GIBF5	4.31e-74	20	523	14	585	FAD-linked oxidoreductase apf9 OS=Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) OX=1279085 GN=apf9 PE=1 SV=1
sp|G2QDQ9|VAO15_MYCTT	1.08e-69	26	523	27	574	VAO-type flavoprotein oxidase VAO615 OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=MYCTH_2305637 PE=1 SV=1
sp|A0A0E0RTV6|ZEB1_GIBZE	2.49e-68	26	523	26	563	FAD-linked oxidoreductase ZEB1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=ZEB1 PE=2 SV=2
sp|A1CFM2|PATO_ASPCL	7.88e-68	27	525	29	570	FAD-linked oxidoreductase patO OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patO PE=1 SV=1
sp|G0R6T3|SORD_HYPJQ	1.18e-66	17	522	29	572	FAD-linked oxidoreductase sor8 OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=sor8 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000253	0.999718	CS pos: 22-23. Pr: 0.7961

TMHMM  Annotations     

There is no transmembrane helices in HCDG_08050-t38_1-p1.