CAZyme Information: HCDG_07930-t38_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCDG_07930-t38_1-p1
• CAZy Family: GT4
• CAZyme Description: endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328	GG692432|CGC1	32543.78	4.4501

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumH143	9796	544712	249	9547

• Gene Location: location=GG692432:1079120-1080182(-)

Full Sequence      

MHSLSLLYLIAAAGSALGHIEMSEPVPFRSRFGSGGDVDYSMTSPLLADGSNFPCKGYQH
DSVSKPSATYKAGGSGEIKLAGTATHGGGSCQISLSYDQGKTFKVIESIIGGCPLPMQYS
FKIPSSAPSGEALLAWTWFNKIGNREMYMNCAPVSIEGGSGDKAAFDKLPDIYVANVGNG
KTTIEGQDVVFPNPGDDTTGTDKPSGDAPAGSSAAGNASAPAAASGAASTPDASPAASPT
PAANTPAANTPAANTPAANSPAANTPAANTPAATTPALQINANAASSAAETPSPSESAPA
SESTPSDASPGIGGSDNLRITCNCSSLP

Enzyme Prediction     

No EC number prediction in HCDG_07930-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA11	19	200	2.5e-71	0.9633507853403142

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185594	PTZ00395	1.62e-06	230	276	417	463	Sec24-related protein; Provisional
223021	PHA03247	2.68e-06	192	315	2739	2855	large tegument protein UL36; Provisional
185594	PTZ00395	3.03e-06	230	317	432	517	Sec24-related protein; Provisional
185594	PTZ00395	6.06e-06	96	312	327	545	Sec24-related protein; Provisional
237030	kgd	6.75e-06	232	311	35	114	multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS65347.1|AA11	1.61e-151	1	328	1	307
QSS73131.1|AA11	1.89e-149	1	328	1	323
QSS55105.1|AA11	2.70e-149	1	328	1	343
QVM11324.1|AA11	5.10e-74	15	197	12	197
QMW48536.1|AA11	1.57e-69	10	196	11	199

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAH_A	6.60e-39	19	195	1	196	Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Zn [Aspergillus oryzae],4MAI_A Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Cu(I) [Aspergillus oryzae]

Swiss-Prot Hits     

HCDG_07930-t38_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000268	0.999688	CS pos: 18-19. Pr: 0.9736

TMHMM  Annotations     

There is no transmembrane helices in HCDG_07930-t38_1-p1.