CAZyme Information: HCDG_07515-t38_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCDG_07515-t38_1-p1
• CAZy Family: GT22
• CAZyme Description: cysteine desulfurase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
799	GG692431|CGC2	86978.78	7.0310

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumH143	9796	544712	249	9547

• Gene Location: location=GG692431:1125538-1129522(+)

Full Sequence      

MALPSEGRTTIRSFLTDEEIIEPTSDRYASATDFWTAYKNPKPQLVLRPKSLPALQKTVQ
YLCASDLDFSVRSGGNNTSGAKHVQLSMSAFDSFEFDQDSETVTIGAGQTWGEVDRKVEE
AAPGYTVLSTRVPFVGVAGSLLLGGMSWFSGEHGLCSDPHNLLDAHVVLPDGRMLWASTE
PDLLWALRGGGGNFGASLRSLAGNTIMLSSPLVDTSSIDPDFVVRIAKFYEQAVEANKAL
GSGTLVVLEVLGKIFGPNYERLRHIKTKYDPKASPQTGQLNNHAASLPSITMSNLAPSAF
RQALRAYPRRCASIRPAAPRTAAARRCYTSESKPARAQSSVDLDVDVAIKTGQRPFAEQT
GIRPHNVTVPGTAVDSDAMMGPSTGILKQATVLDQGNRPIYLDMQATTPTDPRVLDAMLP
FLTGLYGNPHSRTHAYGWETEKATEQAREHVAKLIGADPKEIIFTSGATESNNMSIKGVA
KFFGRSGKKKHIITSQTEHKCVLDSCRHLQDEGFEVTYLPVRSNGLIDLKDLEAAIRPET
ALVSIMTVNNEIGVIQPVKEIGALCRSKRVFFHTDAAQAVGKIPIDVNEWNVDLLSISGH
KIYGPKGIGACYVRRRPRVRIDPIITGGGQERGLRSGTLAPHLAVGIGEACRIAKEEMEY
DAKRIKALSKRLLDGLLSMEHTSLNGDPEKHYPGCVNVSFAYVEGESLLMALKDIALSSG
SACTSASLEPSYVLRALGNSDESAHSSIRFGIGRFTTESEIDYVLKAVRERVSFLRELSP
LWELVQEGVDLNTIEWSQH

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	31	195	2.6e-34	0.3646288209606987

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178257	PLN02651	0.0	400	762	1	364	cysteine desulfurase
184450	PRK14012	0.0	399	799	4	404	IscS subfamily cysteine desulfurase.
131061	IscS	0.0	399	799	4	402	cysteine desulfurase IscS. This model represents IscS, one of several cysteine desulfurases from a larger protein family designated (misleadingly, in this case) class V aminotransferases. IscS is one of at least 6 enzymes characteristic of the IscSUA-hscAB-fsx system of iron-sulfur cluster assembly. Scoring almost as well as proteobacterial sequences included in the model are mitochondrial cysteine desulfurases, apparently from an analogous system in eukaryotes. The sulfur, taken from cysteine, may be used in other systems as well, such as tRNA base modification and biosynthesis of other cofactors. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other, Protein synthesis, tRNA and rRNA base modification]
224029	NifS	0.0	398	783	1	386	Cysteine sulfinate desulfinase/cysteine desulfurase or related enzyme [Amino acid transport and metabolism].
132443	FeS_nifS	0.0	400	781	1	379	cysteine desulfurase NifS. Members of this protein family are NifS, one of several related families of cysteine desulfurase involved in iron-sulfur (FeS) cluster biosynthesis. NifS is part of the NIF system, usually associated with other nif genes involved in nitrogenase expression and nitrogen fixation. The protein family is given a fairly broad interpretation here. It includes a clade nearly always found in extended nitrogen fixation genomic regions, plus a second clade more closely related to the first than to IscS and also part of NifS-like/NifU-like systems. This model does not extend to a more distantly clade found in the epsilon proteobacteria such as Helicobacter pylori, also named NifS in the literature, built instead in TIGR03403.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX49222.1|AA7|CBM1	2.21e-09	43	195	164	321
CCA72155.1|AA7	1.09e-08	17	194	69	265
QGA17347.1|AA7	1.62e-08	43	195	48	205
UJO23499.1|AA7	8.90e-08	43	195	63	219
QRW15212.1|AA7	8.96e-08	2	195	20	221

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WGB_A	1.08e-209	383	799	11	426	Crystal Structure of the Human mitochondrial Cysteine Desulfurase in complex with ISD11 and E. coli ACP1 protein at 2.75A [Homo sapiens]
6NZU_A	3.77e-209	398	799	3	403	Structure of the human frataxin-bound iron-sulfur cluster assembly complex [Homo sapiens],6NZU_E Structure of the human frataxin-bound iron-sulfur cluster assembly complex [Homo sapiens]
5WKP_A	4.20e-209	398	799	6	406	Crystal Structure of the Human mitochondrial Cysteine Desulfurase in complex with ISD11 and Iron-Sulfur Cluster Scaffold Protein ISCU1, and E. coli ACP1 protein at 3.15A [Homo sapiens],5WKP_E Crystal Structure of the Human mitochondrial Cysteine Desulfurase in complex with ISD11 and Iron-Sulfur Cluster Scaffold Protein ISCU1, and E. coli ACP1 protein at 3.15A [Homo sapiens],5WLW_A Crystal Structure of the Human Mitochondrial Cysteine Desulfurase with active Cysteine Loop within ISCU1 active site, coordinating Zn ion. Complexed with human ISD11 and E. coli ACP1 at 3.3A. [Homo sapiens],5WLW_E Crystal Structure of the Human Mitochondrial Cysteine Desulfurase with active Cysteine Loop within ISCU1 active site, coordinating Zn ion. Complexed with human ISD11 and E. coli ACP1 at 3.3A. [Homo sapiens],6UXE_A Structure of the human mitochondrial desulfurase complex Nfs1-ISCU2(M140I)-ISD11 with E.coli ACP1 at 1.57 A resolution showing flexibility of N terminal end of ISCU2 [Homo sapiens],6W1D_A Structure of human mitochondrial complex Nfs1-ISCU2 (WT)-ISD11 with E.coli ACP1 at 1.8 A resolution (NIAU)2 [Homo sapiens],6WI2_A Structure of human mitochondrial complex Nfs1-ISCU2-ISD11 with E.coli ACP1 at 1.95 A resolution (NIAU)2. N-terminal mutation of ISCU2 (L35) traps Nfs1 Cys loop in the active site of ISCU2 without metal present. [Homo sapiens],6WIH_A N-terminal mutation of ISCU2 (L35H36) traps Nfs1 Cys loop in the active site of ISCU2 without metal present. Structure of human mitochondrial complex Nfs1-ISCU2(L35H36)-ISD11 with E.coli ACP1 at 1.9 A resolution (NIAU)2. [Homo sapiens],7RTK_A Chain A, Cysteine desulfurase, mitochondrial [Homo sapiens]
5USR_A	8.70e-209	383	799	11	426	Crystal structure of human NFS1-ISD11 in complex with E. coli acyl-carrier protein at 3.09 angstroms [Homo sapiens],5USR_C Crystal structure of human NFS1-ISD11 in complex with E. coli acyl-carrier protein at 3.09 angstroms [Homo sapiens],5USR_E Crystal structure of human NFS1-ISD11 in complex with E. coli acyl-carrier protein at 3.09 angstroms [Homo sapiens],5USR_G Crystal structure of human NFS1-ISD11 in complex with E. coli acyl-carrier protein at 3.09 angstroms [Homo sapiens]
5KZ5_1	1.54e-202	408	799	1	391	Architecture of the Human Mitochondrial Iron-Sulfur Cluster Assembly Machinery: the Complex Formed by the Iron Donor, the Sulfur Donor, and the Scaffold [Homo sapiens],5KZ5_2 Architecture of the Human Mitochondrial Iron-Sulfur Cluster Assembly Machinery: the Complex Formed by the Iron Donor, the Sulfur Donor, and the Scaffold [Homo sapiens],5KZ5_3 Architecture of the Human Mitochondrial Iron-Sulfur Cluster Assembly Machinery: the Complex Formed by the Iron Donor, the Sulfur Donor, and the Scaffold [Homo sapiens],5KZ5_4 Architecture of the Human Mitochondrial Iron-Sulfur Cluster Assembly Machinery: the Complex Formed by the Iron Donor, the Sulfur Donor, and the Scaffold [Homo sapiens],5KZ5_M Architecture of the Human Mitochondrial Iron-Sulfur Cluster Assembly Machinery: the Complex Formed by the Iron Donor, the Sulfur Donor, and the Scaffold [Homo sapiens],5KZ5_N Architecture of the Human Mitochondrial Iron-Sulfur Cluster Assembly Machinery: the Complex Formed by the Iron Donor, the Sulfur Donor, and the Scaffold [Homo sapiens],5KZ5_O Architecture of the Human Mitochondrial Iron-Sulfur Cluster Assembly Machinery: the Complex Formed by the Iron Donor, the Sulfur Donor, and the Scaffold [Homo sapiens],5KZ5_P Architecture of the Human Mitochondrial Iron-Sulfur Cluster Assembly Machinery: the Complex Formed by the Iron Donor, the Sulfur Donor, and the Scaffold [Homo sapiens],5KZ5_Q Architecture of the Human Mitochondrial Iron-Sulfur Cluster Assembly Machinery: the Complex Formed by the Iron Donor, the Sulfur Donor, and the Scaffold [Homo sapiens],5KZ5_R Architecture of the Human Mitochondrial Iron-Sulfur Cluster Assembly Machinery: the Complex Formed by the Iron Donor, the Sulfur Donor, and the Scaffold [Homo sapiens],5KZ5_S Architecture of the Human Mitochondrial Iron-Sulfur Cluster Assembly Machinery: the Complex Formed by the Iron Donor, the Sulfur Donor, and the Scaffold [Homo sapiens],5KZ5_T Architecture of the Human Mitochondrial Iron-Sulfur Cluster Assembly Machinery: the Complex Formed by the Iron Donor, the Sulfur Donor, and the Scaffold [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0DN31|NFS1_ARTBC	1.04e-291	292	799	1	503	Cysteine desulfurase, mitochondrial OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05732-2 PE=3 SV=1
sp|P87185|NFS1_CANAL	3.12e-217	396	799	85	488	Cysteine desulfurase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=NFS1 PE=2 SV=1
sp|P25374|NFS1_YEAST	2.81e-215	344	799	54	497	Cysteine desulfurase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NFS1 PE=1 SV=2
sp|P87187|NFS1_CANMA	7.09e-215	372	799	53	484	Cysteine desulfurase, mitochondrial OS=Candida maltosa OX=5479 GN=SPL1 PE=3 SV=1
sp|O60028|NFS1_ASHGO	1.31e-211	325	799	7	490	Cysteine desulfurase, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=NFS1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HCDG_07515-t38_1-p1.