CAZyme Information: HCDG_07316-t38_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCDG_07316-t38_1-p1
• CAZy Family: GT21
• CAZyme Description: mannosyltransferase complex subunit

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
413		47971.95	5.6033

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumH143	9796	544712	249	9547

• Gene Location: location=GG692431:592831-594527(+)

Full Sequence      

MATQPTHMGRAGHSRSHLTDDFQLETVRYYDLSNFQGTARGWERQERVLLCTPLRDAAPH
LPMFFSHLRNLTYPHHLIDLAFLVSDSKDDTLEMLTKMLEELQADPDSKQHYGEISVIEK
DFGQKVNQDVESRHGFAAQASRRKLMAQARNWLLSATLRPTHSWVYWRDADVETAPFTIL
EDLMRHNKDVIVPNVWRPLPDWLGGEQPYDLNSWKESETALALAETLDEDAVIVEGYAEY
ATWRPHLAYLRDPYGDPDTEMEIDGVGGVSILAKARVFRSGVHFPAFSFEKHAETEAFGK
MAKRMKFSVVGLPHYTIWHLYEPSLDDIRHMEEMERERKEREEEEKKKAELAQLMKEEFK
DTKDEWEKDGKAIQNILKQDELAKKGEKKTTKNEDVKKRSNSGVEDVDKRQQQ

Enzyme Prediction     

No EC number prediction in HCDG_07316-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	25	288	2.6e-125	0.9888059701492538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	6.04e-162	26	288	1	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS53764.1|GT62	2.10e-277	20	413	82	475
QSS75645.1|GT62	2.10e-277	20	413	82	475
APA12986.1|GT62	1.02e-221	20	388	98	462
ATZ55714.1|GT62	2.20e-220	20	388	86	450
CCD52067.2|GT62	2.20e-220	20	388	86	450

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	4.87e-62	27	324	6	304	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32629|ANP1_YEAST	2.13e-162	15	373	50	408	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|O74745|ANP1_SCHPO	6.58e-152	27	334	77	386	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P23642|VAN1_YEAST	6.63e-128	26	331	171	523	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|Q00314|VAN1_CANAX	4.99e-121	19	334	68	433	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P53697|MNN9_CANAL	1.21e-66	21	322	67	368	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999903	0.000131

TMHMM  Annotations     

There is no transmembrane helices in HCDG_07316-t38_1-p1.