CAZyme Information: HCDG_04902-t38_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCDG_04902-t38_1-p1
• CAZy Family: GH47
• CAZyme Description: BNR/Asp-box repeat domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367		40224.37	8.1579

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumH143	9796	544712	249	9547

• Gene Location: location=GG692424:1515688-1516984(+)

Full Sequence      

MGAHCQLKLLRRTRGLPERFGSCERQGINAAQHDTKGKRYVRLAKLSDGSVLAGFTADEG
GVKVIKTSKRTNGDKGFFPFGEITRGDWDIGNIYLLEVAPSVVLGAFRNHTSVGPNLIHS
RITVCKSTNGGKDWKFASQAFEMDGNLGAWEPFMRLAESNPNEIQLTYSQEFAANEQRTM
LVTSTDRGDTWSTPKAVSWKPKQRDGMTGIAKTKDGNRDALAMVFETTDNVPFFNVKAVI
SYDDGASWCHRQDVQVAPRGKNAGAPQIASFADGSLVVVYMADEDIEGNWPHKANIKATF
SGPPKDGKMCWSPPQVVKEADAFWPGALQFEDSTVVVTYDADGARAKPIRLNSLWSMGGQ
RFCGGCE

Enzyme Prediction     

No EC number prediction in HCDG_04902-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	38	291	3.6e-50	0.8794788273615635

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	2.62e-08	118	315	43	241	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	7.05e-08	127	289	179	331	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS53313.1|GH93	4.11e-249	40	367	63	390
QSS58347.1|GH93	6.12e-239	40	367	42	369
QSS76105.1|GH93	3.80e-227	40	352	42	354
EAA62412.1|GH93	9.37e-104	40	351	56	366
BCS24955.1|GH93	8.07e-102	40	352	53	365

PDB Hits     

HCDG_04902-t38_1-p1 has no PDB hit.

Swiss-Prot Hits     

HCDG_04902-t38_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HCDG_04902-t38_1-p1.