CAZyme Information: HCDG_04495-t38_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCDG_04495-t38_1-p1
• CAZy Family: GH37
• CAZyme Description: endo-1,3-beta-glucanase Engl1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
797		86333.01	6.4225

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumH143	9796	544712	249	9547

• Gene Location: location=GG692423:1951281-1954079(+)

Full Sequence      

MSSWLVAILIMMTMRRFFPGTQALPHCALHQDCHAYPNGTDGLDFGLTSQLPRTTLPAAP
ASLSVGISITISIPLPIRPSTTASQPPPSSITSSAASSSPAPTAPSSSSSSASTLVPLPK
PPPMNGQNAFEPVGTGPPPANIPSRGDHPVKPDHIVGSTGPIPTNKFFANFFLGSQTGPS
FTHPYGVAWAKGKGPVTSYGLMVSNIEPSQLAFGPMSQSIPGNPVQFYINPIGIQSMILS
AAELGPSSVLVVSKPSAFSATILLSPGPGSTSHIAFPLVQGMGFVTAVYTKLQPTVQSGV
FFRQFEQLGSLKLGLFKYKVTLEDGTAWLIYVTSADGTDPQLRLEDHSLIRGISGFSGTI
QICKNPLGGEGEGIYDRSAGVYAVEVQLAGFVVADQQTGTYSFSWEKQGLDVSTTPLLMF
ALPHHCDSFDKNTKSRMTGLHLRTTTKGMATGIVGDSWTMVETSLPIGFGKFSMLVYTVE
KLAEDPSLAENAFRLLKEAFAKFVRNEQKWRLVYDTVWKGIVSSGSYVTRDPGLDFGNTY
YNDHHFHYGYFILSAAIMGTLDPSWIAGNKDWVNALVRDVSTPVPDDPFFPCFRSFDWYN
GHSWAKGLFESYDGKDEESSSEDALFAYALKLWGKAIGDASMEARGNLMLAVLARSLHAY
FLLRSDNVNHPANFIANKVTGILFENKVDHTTYFGTNLEYIQGIHMIPLTASSSYTRDQL
FVKEEWEAMFAETACTPASKVQGGWQGILFANLALIDPFTSWEFFSHDPFDYSKIDGGAT
RTWYLAFAAGLGGGPRL

Enzyme Prediction     

EC	3.2.1.39:20	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	469	787	4.1e-131	0.4919614147909968
GH81	156	466	1.2e-70	0.41639871382636656

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	0.0	122	795	48	759	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	0.0	468	785	37	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	2.65e-155	148	473	1	320	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS57493.1|GH81	0.0	1	797	5	852
QSS67487.1|GH81	0.0	1	797	5	852
QSS66079.1|GH81	0.0	1	797	5	854
UDD56325.1|GH81	6.38e-305	125	793	6	723
BAE58039.1|GH81	1.85e-302	125	790	6	720

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	3.02e-96	125	789	4	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	5.21e-96	125	789	29	741	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	4.44e-93	125	789	4	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	1.98e-26	514	758	393	627	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5UPI_A	4.99e-19	542	778	439	671	Chain A, BH0236 protein [Halalkalibacterium halodurans C-125],5UPM_A Chain A, BH0236 protein [Halalkalibacterium halodurans C-125],5UPN_A Chain A, BH0236 protein [Halalkalibacterium halodurans C-125],5UPO_A Chain A, BH0236 protein [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	3.08e-289	124	790	188	901	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	1.07e-157	132	795	6	706	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|P53753|ENG1_YEAST	4.01e-155	128	791	401	1112	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	1.67e-140	130	790	429	1140	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|Q12168|ENG2_YEAST	4.44e-139	139	788	87	775	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000239	0.999742	CS pos: 23-24. Pr: 0.9559

TMHMM  Annotations     

There is no transmembrane helices in HCDG_04495-t38_1-p1.