CAZyme Information: HCDG_04239-t38_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCDG_04239-t38_1-p1
• CAZy Family: GH3
• CAZyme Description: extracellular chitinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355		39233.32	5.4746

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumH143	9796	544712	249	9547

• Gene Location: location=GG692423:864193-865467(+)

Full Sequence      

MVSMVLYGILLFTPFNIDWEYPGGNGLDYKETSNSAKKSEIDNFPLFLKEIRNAIGTEKQ
LSIAVPGRKSDMIAYTPENGPAIWESVDFVNVLFSNKPSALTSFERMLTVLFKIMTYDLI
NRRDNVTAHHTSVKGCLETVQNYLDVKLPPEKINLGFAFYAKYFTLDPKANCTSEKPVGC
PIVHGEFENGTDAGTSGSVTFEVAQISPPRAPVGVSPNATCGPLNEFRCEDGFCCSSAGY
CGETPQHCNSGCQPNYGKCDGVDTGGSFRRARTNGMTDREQGGRYYVDEQAKLFWTWETT
DLIARKFEQIVCAKKLGGVMAWGLGLDTYDWSHLEAVEKGMEGYKGTAGNKTSYR

Enzyme Prediction     

EC	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	8	329	1e-29	0.6385135135135135

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395573	Glyco_hydro_18	1.71e-34	15	327	108	307	Glycosyl hydrolases family 18.
214753	Glyco_18	1.86e-23	15	327	111	334	Glyco_18 domain.
119365	GH18_chitinase	6.14e-19	17	160	131	262	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
119351	GH18_chitolectin_chitotriosidase	3.85e-16	15	166	116	249	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
119349	GH18_chitinase-like	1.13e-14	15	96	108	177	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS67261.1|CBM18|GH18	9.60e-258	12	355	120	463
QSS66279.1|CBM18|GH18	5.43e-245	12	355	136	470
QSS57709.1|CBM18|GH18	7.71e-238	12	355	120	441
AIW06010.1|CBM18|GH18	3.22e-115	16	343	121	422
QQK48241.1|CBM18|GH18	1.67e-114	12	348	120	432

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JM7_A	7.11e-06	12	182	118	273	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis],6JMB_A Chain A, ofchtiv-allosamidin [Ostrinia furnacalis]

Swiss-Prot Hits     

HCDG_04239-t38_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.489295	0.510700	CS pos: 18-19. Pr: 0.3344

TMHMM  Annotations     

There is no transmembrane helices in HCDG_04239-t38_1-p1.