CAZyme Information: HCDG_03127-t38_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCDG_03127-t38_1-p1
• CAZy Family: GH17
• CAZyme Description: chitinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348		37267.61	5.0616

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumH143	9796	544712	249	9547

• Gene Location: location=GG692421:2575503-2576718(-)

Full Sequence      

MLLSNEWVDERQPVDGTEGYLRALVHRKRDSKVKVLLSIGGGGNGGDIVGSRNFAAVAAS
PAAVERFLSSAADLMNKFQLDGLDINWEHPETLEQGYDYNTLLYRLRERFPSPPYLLTTA
LSAGEWVLSKINLVEAHLYVDLINLMTYDFSGPWMPLSGHHAQLYAPPDPAKSNLGSDGG
DDDECHHVGWGVPAGKILLGIPVYGRAFPGANGINQPYERGTAGGEKVFDYRELPLPGTE
EVHDAVLCAAYCVDFGGCSGSSSSSSGGGGGDGPAAGFISYDSPRTVMQKAQFVSEYELG
GLFYWHLAADAEVGTERSLVATGYRALHSWMMSTSNGGAGGKRRRGGG

Enzyme Prediction     

No EC number prediction in HCDG_03127-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	30	314	4.5e-53	0.777027027027027

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	4.24e-58	1	310	42	334	Glyco_18 domain.
119365	GH18_chitinase	7.24e-53	7	310	61	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
395573	Glyco_hydro_18	5.43e-52	27	310	58	307	Glycosyl hydrolases family 18.
225862	ChiA	3.28e-41	19	310	115	423	Chitinase, GH18 family [Carbohydrate transport and metabolism].
119351	GH18_chitolectin_chitotriosidase	1.59e-32	6	305	49	336	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS61652.1|GH18	4.46e-202	3	324	60	382
ACT90641.1|GH18	2.20e-103	3	328	79	380
QVM13509.1|GH18	2.20e-103	3	328	79	380
QQK40281.1|GH18	2.97e-99	3	328	72	362
QKX53256.1|GH18	3.83e-98	3	328	89	388

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EPB_A	1.06e-38	16	327	102	398	Structure of Chitinase 42 from Trichoderma harzianum [Trichoderma harzianum]
6IGY_A	4.39e-38	5	322	74	371	Crystal structure of Aspergillus niger chitinase B [Aspergillus niger]
1LL6_A	6.12e-38	3	322	47	358	Chain A, CHITINASE 1 [Coccidioides immitis],1LL6_B Chain B, CHITINASE 1 [Coccidioides immitis],1LL6_C Chain C, CHITINASE 1 [Coccidioides immitis],1LL6_D Chain D, CHITINASE 1 [Coccidioides immitis]
6YLJ_A	2.05e-37	16	327	102	398	Chain A, Endochitinase 42 [Trichoderma harzianum],6YN4_A Chain A, Endochitinase 42 [Trichoderma harzianum],7AKQ_A Chain A, Endochitinase 42 [Trichoderma harzianum]
1D2K_A	3.20e-37	3	322	47	358	Chain A, CHITINASE 1 [Coccidioides immitis],1LL4_A Chain A, Chitinase 1 [Coccidioides immitis],1LL4_B Chain B, Chitinase 1 [Coccidioides immitis],1LL4_C Chain C, Chitinase 1 [Coccidioides immitis],1LL4_D Chain D, Chitinase 1 [Coccidioides immitis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A6N6J0|CHI46_TRIHA	1.64e-38	27	327	117	405	Endochitinase 46 OS=Trichoderma harzianum OX=5544 GN=chit46 PE=1 SV=1
sp|G5EAZ3|CHIB1_EMENI	2.49e-38	4	310	62	347	Endochitinase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chiB PE=1 SV=1
sp|Q92222|CHIB_EMEND	2.49e-38	4	310	62	347	Endochitinase B OS=Emericella nidulans OX=162425 GN=chiB PE=1 SV=3
sp|P48827|CHI42_TRIHA	2.83e-37	16	327	102	398	Endochitinase 42 OS=Trichoderma harzianum OX=5544 GN=chit42 PE=1 SV=1
sp|E9ERT9|CHI1_METRA	1.07e-36	4	312	96	386	Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chit1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HCDG_03127-t38_1-p1.