CAZyme Information: HCDG_02709-t38_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCDG_02709-t38_1-p1
• CAZy Family: GH16
• CAZyme Description: trehalose-phosphatase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
876		98983.20	7.5589

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumH143	9796	544712	249	9547

• Gene Location: location=GG692421:1376734-1379725(-)

Full Sequence      

MASNDVGTPSGTASGNPESIAPEMSPKTTDADHFLRSVGNNDAELVVNIQHGTLPKFPGS
PTEAAKGVKSGADLLRRLSLVRSPKPAAPSIEPQEGHPGLHLTGRIISAAFCIPYKLRIR
PGRDWELKHRPGTSALFDSFSYLASSKTSWNHIMVGWTGEIEQIHTPESGHATSPGQSLP
AGTVPTSLNKASAPVPIDPSEKPSYSFQDGICVTQQDRIHLEAQLRNSRFGRVLPIWLTD
EQEYPDQNLYLKDQGRWRRYPERELYPVLHYKQRSSTDGWSERKWWADYVRLNKLFADRI
LETYTPGDIVWIHDYHLFLLPGIIRQMVPNIYIGFFLHAPFPSSEFMRCLSKRKDILTGV
LGANMIDAVRKLAYEEPGIGEIVNSIRKQYHGKRIIIGRDRLDSVRGVTQKLMAFETFLE
RYPQWRNKVVLIQVTNPTSVEEEKEESEAKISSQMSHLVSTINGRFGSLSFSPVQHYSRY
LVPQEYFALLRAADIGLITSVRDGMNTTSLEYVVCQHENHGPLILSEFSGTAGSLSSAIH
INPWDLGGVADVINQALLMTPEEREAQHSQLYKYVTTHTIISWSDKYLKRLLTNLSSFDQ
SIATPALDKSRLLSQYRKSRGRLFMFDYDGTLTPIVKDPQAAIPSDRVLRTIKTLAADRK
NSVWIISGRDQAFLDEWMGHISELGLSAEHGCFIRHPRNDDWENLTEKSNMGWQKEVLEI
FQHYTERTQGSFIERKRVALTWHYRRADPEYGTFQATECRKHLENTVLKRWPVEVLSGKA
NLEVRPTFINKGSIATRLVEEYKHGLGQDPDFVLCLGDDFTDEDMFRALANSSLPRDRVF
SVTVGASSKQTLANWHLLEPADVIATIALLNSKTSS

Enzyme Prediction     

EC	3.1.3.12:1	3.1.3.12:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	375	591	8.3e-81	0.44842105263157894
GT20	101	366	2.1e-46	0.4105263157894737

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184712	PRK14501	0.0	210	870	50	723	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	6.09e-159	105	591	1	462	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	1.76e-138	233	591	75	468	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
177855	PLN02205	1.44e-133	262	874	154	848	alpha,alpha-trehalose-phosphate synthase [UDP-forming]
215556	PLN03064	9.65e-133	265	826	186	807	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS67563.1|GT20	0.0	1	876	1	922
QSS60889.1|GT20	0.0	1	823	61	929
BCR91687.1|GT20	0.0	58	876	78	954
QMW46130.1|GT20	0.0	28	875	53	942
QMW34075.1|GT20	0.0	28	875	53	942

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DXN_A	6.95e-156	602	872	1	271	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 2 [Aspergillus fumigatus Af293],5DXO_A Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293],5DXO_B Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293]
5DXL_A	6.12e-151	604	872	3	271	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 1 [Aspergillus fumigatus Af293]
5DXF_A	4.43e-115	89	594	16	526	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
5DXI_A	1.70e-94	604	870	5	297	Structure of C. albicans Trehalose-6-phosphate phosphatase C-terminal domain [Candida albicans SC5314],5DXI_B Structure of C. albicans Trehalose-6-phosphate phosphatase C-terminal domain [Candida albicans SC5314]
5DX9_A	1.78e-73	604	864	3	295	Chain A, trehalose-6-phosphate phosphatase [Cryptococcus neoformans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P31688|TPS2_YEAST	1.18e-207	105	870	15	846	Trehalose-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS2 PE=1 SV=3
sp|P78875|TPP1_SCHPO	6.27e-198	91	875	25	817	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tpp1 PE=1 SV=2
sp|Q9P4D3|TPS2_ZYGRO	2.13e-190	101	870	6	853	Trehalose-phosphatase OS=Zygosaccharomyces rouxii OX=4956 GN=TPS2 PE=1 SV=1
sp|O14145|TPS2_SCHPO	3.85e-154	105	863	16	842	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tps2 PE=3 SV=1
sp|Q54NU9|TPSB_DICDI	9.31e-144	260	831	142	752	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HCDG_02709-t38_1-p1.