CAZyme Information: HCDG_02621-t38_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCDG_02621-t38_1-p1
• CAZy Family: GH16
• CAZyme Description: mannosyl-oligosaccharide 1,2-alpha-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
516	GG692421|CGC2	58651.64	6.3663

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumH143	9796	544712	249	9547

• Gene Location: location=GG692421:752130-753760(-)

Full Sequence      

MNLTSRVQNARNWIHTSLRYDQDHPVNTFETTIRMLGGLLSAHYLSTTYPNLSPIADDDD
GAPGEDLYIEKATGLADRLLGAFESPSGVPYASINLNTSVGVESHMDFGASSTAEATTLQ
LEFKYLAKLTGEANYWEKVEKVMEVVEANGMEGGLVPIFIEPSSGKFMGQNIRLGSRGDS
YYEYLIKQYLQTSREEPIYLDMWNEALMGIREHLVTYTKHASLTVIGERPNGLKHELVPK
MDHLVCFMPGTISLAATGGLPISQARKTSGWGHKQEEEILLAKELMKTCWATYVATNTGL
APEITYFEIDDPPRMMKNVFPDLRKNPAAAKSALADLHLTSKPLYPLTNANSVWRKDVVI
MPQDKHNLQRPETVESLLYMYRILEDDTYRHWGWQMFKNFVNHTSISVQDRDPPIRDPHN
KNVDLEAKRRTPSSHIRAFTSLDNVDVIPAAQRDNMESFWLAETLKYFYLLFSDREFLPL
EATVFNTEAHVFPRFQMGQLFKTGWKRKHGKGSWLS

Enzyme Prediction     

EC	3.2.1.113:99

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	1	494	3.2e-135	0.8923766816143498

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	0.0	1	494	47	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	4.90e-120	1	495	124	519	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS49011.1|GH47	0.0	1	516	20	535
QSS71063.1|GH47	0.0	1	516	20	535
QSS62240.1|GH47	0.0	1	516	192	707
QVM12334.1|GH47	4.63e-275	1	508	87	590
QVM12333.1|GH47	2.44e-273	1	508	198	701

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1DL2_A	1.06e-112	5	505	74	509	Crystal Structure Of Class I Alpha-1,2-mannosidase From Saccharomyces Cerevisiae At 1.54 Angstrom Resolution [Saccharomyces cerevisiae]
1G6I_A	1.46e-112	5	505	108	543	Crystal structure of the yeast alpha-1,2-mannosidase with bound 1-deoxymannojirimycin at 1.59 A resolution [Saccharomyces cerevisiae]
5KIJ_A	1.38e-93	1	493	57	450	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	1.65e-93	1	493	62	455	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	1.75e-93	1	493	62	455	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8J0Q0|MNS1_CANAX	4.23e-140	1	508	92	522	Mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Candida albicans OX=5476 GN=MNS1 PE=3 SV=2
sp|P32906|MNS1_YEAST	3.33e-111	5	505	107	547	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNS1 PE=1 SV=1
sp|Q9P7C3|MNS1_SCHPO	3.26e-110	1	496	100	513	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2E1P5.01c PE=1 SV=2
sp|Q93Y37|MNS3_ARATH	8.03e-106	1	493	181	619	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 OS=Arabidopsis thaliana OX=3702 GN=MNS3 PE=1 SV=1
sp|Q9UKM7|MA1B1_HUMAN	4.27e-90	1	493	301	694	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN1B1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000001

TMHMM  Annotations     

There is no transmembrane helices in HCDG_02621-t38_1-p1.