CAZyme Information: HCDG_02158-t38_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCDG_02158-t38_1-p1
• CAZy Family: GH13
• CAZyme Description: class I alpha-mannosidase 1A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
860		96051.78	4.9494

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumH143	9796	544712	249	9547

• Gene Location: location=GG692420:2336056-2338813(-)

Full Sequence      

MPRFRRYRVFVVFAVISVVSFVHFSRILYGSTPSTFSNESTRIQKQKPLPPPLPAPPRPI
AEPPRSTPLAGNLEDHGFAPESTTAVPTSNPTPAATQVANQPPGQSPVPHSPQQKPTKSD
PQTEPISPLPEEDELQSPGQGRVEVDGFNKTKIRWEKQPEYYPVPPENLIQLPEGAPKTL
PNIQFEFPEESPAAKADREAKLAVIKASFNHSWTGYKAEAWGHDELRPVSGGYRDPFSGW
GATLVDALDTLWIMGMEAEFEEAVEAVKKIDFATSPRRDIPLFETVIRYLGGLIGAYDIS
GGKYQILLDKAVELAEILMGAFDTPNRMPVTYYLWRPKMASRKKRANSRTVTAEIGSLVV
EFTRLAQITEEAKYYDAVARITNELEKFQEKTKIPGIWPTHLDASGCKRVELPVDQTTDM
PTRASPPIIPENRLPERQIQKRDEIDPLLVDAEPANYDVNPDSQLLPPSPVKASSDDDRL
AESTHIVEYGCEDQGFTSPPRSRSDRFTIGGLVDSVYEYLPKQYALLGGLNDQYQAMHER
AMNAIKKYLLFRPMLPDARDVLFIASATTSEPVTEKGDLKHAYEGTHLACFAGGLFAIGA
KLFGIEDDLAIATKLTNGCVWAYGSTTTGIMPEVFEMLPCESLEPCEWNKTRYYDALDPY
FAERKSYHDQTVAEHARQLPDPVQPWHSDANSTPVPTMRQSAPSQAAITPTVSLASTASP
SPLNEGDIPDFLSHEEFAQLTIQEERLPPGISTIPVARYILRPEAIESVFIMYRITGDDS
WRQKGWKMFQAIEAATRTELANSAIKDVTSRVPIPLNEMESFWLAETLKYTYLLFSDPKL
VSLDEYILNTEAHPLKRPLH

Enzyme Prediction     

EC	3.2.1.113:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	209	857	2.4e-174	0.9955156950672646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	0.0	209	857	2	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	6.01e-96	173	860	35	521	glycoside hydrolase family 47 protein; Provisional
223066	PHA03379	3.17e-07	80	173	488	587	EBNA-3A; Provisional
223021	PHA03247	0.002	61	198	2817	2934	large tegument protein UL36; Provisional
224250	YyaL	0.002	288	398	472	582	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS69163.1|GH47	0.0	1	860	1	860
QSS51165.1|GH47	0.0	1	860	1	860
QSS63392.1|GH47	0.0	1	860	1	863
QKX63570.1|GH47	2.70e-254	126	859	138	898
QGA16383.1|GH47	9.74e-247	132	859	151	921

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KIJ_A	8.51e-50	209	855	13	449	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	9.69e-50	209	855	18	454	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	1.01e-49	209	855	18	454	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
1X9D_A	1.36e-49	180	855	60	532	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]
5KK7_A	4.30e-49	209	855	13	449	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UKM7|MA1B1_HUMAN	7.52e-48	180	855	221	693	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN1B1 PE=1 SV=2
sp|B2GUY0|MA1B1_RAT	2.25e-46	146	855	157	651	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man1b1 PE=2 SV=2
sp|O18498|MA1A1_SPOFR	2.63e-46	173	860	170	651	Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Spodoptera frugiperda OX=7108 PE=1 SV=1
sp|A2AJ15|MA1B1_MOUSE	3.07e-46	146	855	158	652	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Mus musculus OX=10090 GN=Man1b1 PE=1 SV=1
sp|Q9C512|MNS1_ARATH	3.43e-46	167	856	67	535	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 OS=Arabidopsis thaliana OX=3702 GN=MNS1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000032	0.000001

TMHMM  Annotations     

Start	End
7	29