CAZyme Information: HCDG_01975-t38_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCDG_01975-t38_1-p1
• CAZy Family: CE5
• CAZyme Description: glucosidase I

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
815		92800.94	4.9647

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumH143	9796	544712	249	9547

• Gene Location: location=GG692420:1605101-1608022(-)

Full Sequence      

MVLALQSLLFLLLSISLAAREDSSAASHEVPILAKELGRASNESLLWGPYRPNLYFGVRP
RLPKSLIMGLMWANVDEFQNIQEKFRHTCEQNEGMAGYGWDEYDIRKGGRQTIHDTGNAI
DLTIDFIKVPGGGNGGNWGARVKGTPRADASPDQATTVVFYAAIEGLGTLELANEVDALG
YKDDVKFTGSTVGLGDFTLDLTRGPESNVHPPRRHAAYDDKPLDRTMVAGLQVPADVLWN
AKSLLFMHMKEEIDATLKKYGTDNPLPPAQLITIANKPDAGNMYFVQRAFEVRYSFSSAS
SPAPMTSTVLTEEIEPASAFFSKKFKEVFPPLPPFNLPKYTEFSKAMFSNLVGGVGYFYG
DSVVDRSNSPEYEEENELFWEETEQARAQVKPSVDGPSELFTSIPSRPFFPRGFLWDEGF
HLIPVIEWDLDLARLEITRSWFNLMDDDGWIAREQILGPEARSKVPTEFQVQYPHYANPP
TLFMILEAFVEKIQLSREQAGVRDAPSDIRSAHLENPDLAILYLRSVYPLLKRQFFWFKK
TQWGDLKSYDREAFSSKEAYRWRGRSIKHILTSGLDDYPRPQPPHPGELHVDLISWMGMM
SRAIRRIAETLEETKDAQEFAAYETRIIRNIDDLHWDKDAQTFCDATVDDFEEHVHVCHK
GYISLFPFMTGLIPADSPRLGPTLDLIQDPKELWSDYGIRSLSKKDEFYGTDENYWRGPI
WININYMILKNLLDVATVPGPHQEQARKMYIQLRQNIVDNVFNQWKETGFAWEQYNPETG
AGQRTQHFTGWTSLVVKMMVMPDLSADHGTRHEEL

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	588	799	3.6e-36	0.43157894736842106

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	305	801	1	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	1.87e-120	45	267	1	221	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	3.48e-07	522	749	359	561	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
236653	PRK10137	1.20e-04	591	799	578	779	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS50985.1|GH63	0.0	1	815	1	818
QSS68976.1|GH63	0.0	1	815	1	818
QSS63216.1|GH63	0.0	1	815	1	818
QVM12625.1|GH63	0.0	12	806	15	808
BCR88942.1|GH63	0.0	24	815	19	816

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	1.66e-176	35	799	5	800	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	2.23e-139	45	808	37	784	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14255|GCS1_SCHPO	1.01e-237	35	799	32	804	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|P53008|CWH41_YEAST	1.64e-175	35	799	35	830	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|Q80UM7|MOGS_MOUSE	2.59e-141	45	799	92	830	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|O88941|MOGS_RAT	4.60e-138	47	799	94	830	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	6.30e-130	45	799	94	833	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000270	0.999719	CS pos: 18-19. Pr: 0.9843

TMHMM  Annotations     

There is no transmembrane helices in HCDG_01975-t38_1-p1.