CAZyme Information: HCDG_01641-t38_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCDG_01641-t38_1-p1
• CAZy Family: AA7
• CAZyme Description: alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
733		84293.16	5.8424

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumH143	9796	544712	249	9547

• Gene Location: location=GG692420:616219-618809(-)

Full Sequence      

MKENTPLTVPLDDHGFSHAIRELRKSSSIELIPQAASDTEANSCAAHTSREPRYSVSYCF
HTRTLLPLQHITDSADESSLPPVFKVWVDNAMESLLEQEDTDKNLQITILDNGPKVVSLG
TFLSDGGRTREIRGTYLLANLLEELHLTKGRHASKLIHFNDVSEDPVSRINRKIKDQYWN
NLTRRLDESMIEVAAKDPKDWNEDPRPRIFVPYGEDKLYEYYCQASKNKPELKLEVQYLP
QGEITADFVHGLRDRPGLLALEMDYSNPDKLRGLQFIVPGGRFNECYYWDSYFACLGLLE
VGRLDLVRDILYNFIFQVKHYGKIPNANRSYYLCRSQPPFLSDLAVRTFKSIDNKEEAAA
VLRAGILAAIREYFTVWMSEPRYDPTTGLSRFKPPGKGIPLEVEEGHFDAVLYSYAGKYA
CTIPEFINQYNSGNVNEPELDEYFMHDRGVRESGHDTSYRFDQGCADLATVDLNCLLYKY
ESDIAWAIKNVFNDKLPIPAEWRTPGMTDDHVEASASWLQRASQRQESVNKYLWDPERGM
YFDYNTNTQKRTTYEYVTTLYPLWCGIASREQADSLVTRALPKFECVGGLSTSTEKSRGP
VSMPHRPPKQWDFPFGWAPHQMLAWDGLKRYGYLREMERLVYRWLQLMVRVAVNYHGAIV
EKYDVTQLDNPSQVDAEYGNQGLDFKYANVEGFGWSNASFSYGLSLIRHRKLMVKALGLC
VPYDDLRMENAHI

Enzyme Prediction     

EC	3.2.1.28:32

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	165	705	8.7e-137	0.9653767820773931

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	2.14e-179	167	707	18	508	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
224541	TreA	6.84e-161	88	707	13	552	Neutral trehalase [Carbohydrate transport and metabolism].
183936	treA	1.18e-52	276	697	151	526	alpha,alpha-trehalase TreA.
237326	treA	1.26e-50	276	697	150	526	alpha,alpha-trehalase TreA.
215307	PLN02567	1.77e-49	192	697	80	534	alpha,alpha-trehalase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS51438.1|GH37	0.0	1	733	1	704
QSS69466.1|GH37	0.0	1	733	1	704
CDP26053.1|GH37	8.67e-260	74	724	77	731
VBB76134.1|GH37	8.67e-260	74	724	77	731
CAP73650.1|GH37	8.67e-260	74	724	77	731

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NIS_A	1.47e-235	88	733	7	653	Neutral trehalase Nth1 from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C]
5JTA_A	3.74e-234	88	733	102	748	Neutral trehalase Nth1 from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
5N6N_C	1.43e-232	88	733	107	753	CRYSTAL STRUCTURE OF THE 14-3-3:NEUTRAL TREHALASE NTH1 COMPLEX [Saccharomyces cerevisiae S288C]
5M4A_A	4.28e-216	139	733	5	600	Neutral trehalase Nth1 from Saccharomyces cerevisiae in complex with trehalose [Saccharomyces cerevisiae]
2JG0_A	2.71e-46	240	707	80	502	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O42783|TREB_NEUCR	9.59e-253	49	724	43	726	Cytosolic neutral trehalase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=treB PE=2 SV=2
sp|O42777|TREB_EMENI	9.86e-252	78	724	83	731	Cytosolic neutral trehalase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=treB PE=1 SV=2
sp|A0A384JRP0|TREA_BOTFB	1.06e-247	84	725	77	720	Cytosolic neutral trehalase OS=Botryotinia fuckeliana (strain B05.10) OX=332648 GN=TRE1 PE=3 SV=1
sp|O42622|TREB_MAGO7	2.33e-246	74	724	66	718	Cytosolic neutral trehalase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=NTH1 PE=2 SV=2
sp|J5K1E2|TREA_BEAB2	3.21e-235	63	723	56	724	Cytosolic neutral trehalase OS=Beauveria bassiana (strain ARSEF 2860) OX=655819 GN=NTH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000008

TMHMM  Annotations     

There is no transmembrane helices in HCDG_01641-t38_1-p1.