CAZyme Information: HCDG_00773-t38_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCDG_00773-t38_1-p1
• CAZy Family: AA3
• CAZyme Description: glucose-methanol-choline oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
502	GG692419|CGC6	55533.50	5.0670

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumH143	9796	544712	249	9547

• Gene Location: location=GG692419:3100657-3102440(-)

Full Sequence      

MAPVFDFIVVGSGPAGSAVASGLARARANPTVLLLEAGDNLEDRNLRVDGQRWLTFQNRN
MNWGYKTVPQEYCNNCELDYSRGRGVGGSSAINFGVYSLGARDDYDEWAKIVGDDAFNWN
HIHARFKELETFHCEVPAGVNKKYAAPKAADHGTTGPLHVGYAAGWEKDLVPTLDIFEQA
GFPLNPDHNSEDNKAVGVVTNGTRYLASKEVILSAGALETPKILMHSGIGPKGQLEKFDI
PVVLDAHAVGQGLRDHYFIPLINTVASTNNDRRAFYGNKKVMDEALEQWKRDATGPWSKF
SCECGIGWFKIDGLTQTKEFEDLPSEEQEYLQKETVPDFPDSALDYTCLLVFLYNAQARG
EVTLQSSDPNEPLRMDPKFLSHPFDRRAAIDSLRDAFRIGKHPAYIKDRLAELAAPKSNS
DEDLYWKQNISSSWHMICTAKMGRAGDADAVVDCDYCVIGIDGLRVADMSVIPVLVSRHI
QAAAYVIGDTCAEKLIKEYNLA

Enzyme Prediction     

No EC number prediction in HCDG_00773-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	201	497	1.3e-73	0.5545774647887324

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	3.38e-80	1	498	4	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.75e-67	1	494	2	526	choline dehydrogenase; Validated
398739	GMC_oxred_C	6.08e-32	357	488	2	140	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	3.89e-21	5	471	56	552	Protein HOTHEAD
366272	GMC_oxred_N	6.01e-18	82	257	23	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS70419.1|AA3_2	0.0	1	502	1	564
QGI76789.1|AA3_2	1.72e-251	1	502	1	564
QGI59587.1|AA3_2	1.72e-251	1	502	1	564
CCT63122.1|AA3_2	1.72e-251	1	502	1	564
QKD46666.1|AA3_2	4.91e-251	1	502	1	564

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	2.86e-42	5	497	2	562	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	7.52e-42	5	497	3	563	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
3LJP_A	1.01e-40	5	493	14	524	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
4H7U_A	1.42e-40	5	500	41	602	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3NNE_A	2.61e-40	5	493	14	524	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B8A1|PKFF_EMENI	1.80e-50	5	500	41	611	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|Q0CJ60|ATC_ASPTN	8.70e-47	5	498	46	596	Cyclase atC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atC PE=1 SV=1
sp|A1CFL2|PATE_ASPCL	8.32e-45	5	492	51	621	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|A6U6Y8|BETA_SINMW	1.43e-44	6	502	4	532	Oxygen-dependent choline dehydrogenase OS=Sinorhizobium medicae (strain WSM419) OX=366394 GN=betA PE=3 SV=1
sp|Q1QXE1|BETA1_CHRSD	1.69e-44	5	495	7	535	Oxygen-dependent choline dehydrogenase 1 OS=Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11) OX=290398 GN=betA1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000020	0.000009

TMHMM  Annotations     

There is no transmembrane helices in HCDG_00773-t38_1-p1.