CAZyme Information: HCBG_08953-t26_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCBG_08953-t26_1-p1
• CAZy Family: GT62
• CAZyme Description: alpha 1,6 mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365		41365.48	7.5296

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumG186AR	9364	447093	110	9254

• Gene Location: location=GG663381:179794-180891(+)

Full Sequence      

MITFRRSIAATLLLLASFYFLLSSRSHSCFRLCHPQPLPIRKAAQKSVAASSESPPSTHN
ESLPPTSAPASLSPEDLARKPLRERLRYQFPYDVHAKFPAYIWQTWKYTPASGKFGDKFR
PMEASWTELHPSFVHEVITDDDADPLLRYLYAPFPEILDAYRSLPLPVLRADFFRYLILL
ARGGIYTDIDTYALKPTIEWLPPHVDRSAIGLIVGIEADAHDREDWYLWYSRQLQFCQWT
IQAKRGHPVLRDIVATITEDTLRMKRAGILRPGIMDKSIVEFTGPAVWTDCVFRYLNDPE
YFEAARPPHGRNLTAKDFAGITVQRKVGDVVVLPITSFSPGVGQMGAQDAGDPMAFVLHQ
FEGGL

Enzyme Prediction     

EC	2.4.1.257:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	123	202	1e-19	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.05e-41	79	357	63	338	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	4.11e-18	125	202	10	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS75991.1|GT32	7.27e-271	1	363	1	363
QSS53427.1|GT32	2.33e-267	1	363	1	363
QKX63547.1|GT32	2.14e-147	70	363	65	354
ABA38731.1|GT32	1.93e-146	69	363	26	321
QVM11372.1|GT32	6.83e-146	69	363	55	350

PDB Hits     

HCBG_08953-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	3.28e-83	82	363	83	373	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	1.50e-64	75	339	103	362	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q9UTR6|OCH1_SCHPO	1.65e-63	88	363	132	391	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P31755|OCH1_YEAST	7.08e-62	82	363	80	467	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P38287|CSH1_YEAST	3.81e-06	128	190	88	147	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.994119	0.005896

TMHMM  Annotations     

Start	End
7	24