CAZyme Information: HCBG_08074-t26_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCBG_08074-t26_1-p1
• CAZy Family: GT34
• CAZyme Description: MIPC synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	GG663375|CGC2	43761.32	9.7252

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumG186AR	9364	447093	110	9254

• Gene Location: location=GG663375:340739-342272(-)

Full Sequence      

MRKGYLIFIVVNFFIVASLVRSVFTLLTLLIEDASADAIRRSDLPSPNSSLIETRPQLIP
KIIHQTYKNESIPAMWLGAQQSCIKLHADYEYKLWTDTKSRDFIAKEYPWFLETFDNYPH
NIQRADAIRYFVLAHYGGTYIDLDDGCNRRLDPLLSYGAWVRRTAPTGISNDAMGAVPQH
PFFLRVIDSLQAYNKNWALPYITVMYSTGPLFLSVIWKEYMLSEPTMTDRVRILMPDEYN
RHSWSFFTHHQGSSWHGKDARLIFWMGGHWMLLTALGFCLAGILGFCLWWAYGRLLFYTS
RCYRYSPLSRRPPPPPPHPPIPQRSSSFSPSRRPGGRLFPGWLRRQSPAKRRGDEETGGY
ADVAYELLGGRKSGSIRKE

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	77	155	1.2e-23	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.02e-77	1	286	10	311	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	6.34e-25	73	157	1	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS73535.1|GT32	7.51e-282	1	379	1	379
QSS66595.1|GT32	1.98e-277	1	379	1	379
BCS17906.1|GT32	1.68e-178	1	367	1	351
EAA57874.1|GT32	4.62e-178	1	371	1	354
AAP47108.1|GT32	4.62e-178	1	371	1	354

PDB Hits     

HCBG_08074-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	1.91e-103	1	302	1	300	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	6.81e-100	1	302	1	292	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.32e-90	37	286	56	312	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	4.76e-88	48	278	46	277	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	4.54e-56	59	266	64	272	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.453522	0.546478	CS pos: 36-37. Pr: 0.2964

TMHMM  Annotations     

Start	End
7	29
270	292