CAZyme Information: HCBG_08042-t26_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCBG_08042-t26_1-p1
• CAZy Family: GT34
• CAZyme Description: glucose-methanol-choline oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
564		62488.67	5.7354

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumG186AR	9364	447093	110	9254

• Gene Location: location=GG663375:259190-261423(+)

Full Sequence      

MTDTYDFIIVGGGNSGLLLATRLATALPESSVVVLESGSAFPDNSHLCQYDRYHAWQRPD
LDLGYITTPQTSLKGQVLPYLRGKGPGGCTNVNFLTYTRGSAEDYNYWAELVGDDSWKWE
HTFRRFKEIETFHAELSEDMKKYSNPLPEDHGYNGPVHVSLPAQWENGITELLDAGTRYG
LPLNMDTNSGNPIGLSIPPTTTFKGYRWTSESIYTNYRPANLKMLTDIKVAKVVFENKVA
VGIQAADGRKFTANREVILSAGVFDSAKILLLSGIGPTQELSQHNIQTIHDLPGVGKGLS
DHPLVVIGASFAPGVGLSDRTQFDSNPAALEAAREQWKRDGTGEMNLHRSCVITGWLKEN
SILTTSEYQNLDTLSKQYLTKDSVPHYELFLAGPHFPPTYVVPEGTSYLSTVVCLMNMQS
RGEITLKSANVNDPPVIDPKYMSHPFDRKMLTLAIREAMKFYQSGAIEKEFKGYVLAPKS
QSDEDIHEFIDENLLPVFHANGTLKMGKPDDPMACTDPSFRVYGVEKLRVVDLSVCPITP
NQPTAYLVAQTAAEKIIAEYGGRR

Enzyme Prediction     

No EC number prediction in HCBG_08042-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	4	558	1.3e-143	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.94e-89	1	556	2	531	choline dehydrogenase; Validated
225186	BetA	1.65e-83	1	564	4	541	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
215420	PLN02785	1.38e-33	4	563	55	583	Protein HOTHEAD
398739	GMC_oxred_C	3.82e-30	419	552	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	9.28e-26	71	303	12	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS73506.1|AA3_2	0.0	1	564	1	567
QSS48722.1|AA3_2	0.0	1	564	1	567
QSZ30159.1|AA3_2	1.86e-146	3	560	7	585
QDS72994.1|AA3_2	3.94e-144	5	561	3	557
APA14917.1|AA3_2	2.01e-142	3	560	7	570

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	5.09e-60	5	559	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	7.21e-60	5	559	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
2JBV_A	8.85e-54	5	562	14	532	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	8.85e-54	5	562	14	532	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
4H7U_A	2.33e-53	5	560	41	601	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B8A1|PKFF_EMENI	7.09e-74	4	556	40	607	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|A0A075TRK9|PATE_PENEN	6.16e-67	3	562	50	626	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|A1CFL2|PATE_ASPCL	6.29e-64	3	562	49	626	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|Q9WWW2|ALKJ_PSEPU	7.28e-63	5	557	2	528	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|Q12062|AFLK_ASPPU	2.21e-62	3	559	73	638	Versicolorin B synthase OS=Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) OX=1403190 GN=aflK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000028	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HCBG_08042-t26_1-p1.