CAZyme Information: HCBG_07324-t26_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCBG_07324-t26_1-p1
• CAZy Family: GT20
• CAZyme Description: GPI mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
441	GG663373|CGC1	48933.67	9.9789

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumG186AR	9364	447093	110	9254

• Gene Location: location=GG663373:985895-987311(+)

Full Sequence      

MPSMFGSPALVFSAAVILRVILLFYGLFQDSHSPVKYTDIDYFVFTDAAKFVSQGRSPYE
RATYRYTPLLAWLLVPTAWGGSLWSAFGKALFAFADIVAGWLIVRVLRQQRHLNMDMPRA
LKYASIWLLNPMVATISTRGSSEGLLGVMVIALVWAVLEKRIVLAGALLGLGVHFKIYPF
IYAPSIIWMLDEGGGHVGAISNLSLSSMINWLRSFFNPSRVLLTFASLCVFSALNLSMYV
TYGLPFMQHTYLHHLTRVDHRHNFSPYNMLLYLSSSSTAQGTSLGSNLESLAFIPQLALS
AALIPLALAKKDLAGTMLAQTFAFVTFNKVCTSQYFLWYMIFLPLYLPYSLFVKKPLLGI
SALTLWIGGQALWLYQGFRLEFHGLSTFAPGLFVASLIFFLVNVWILGIIVADVGVQSVS
SFAMRASGDPSKATKAARDQK

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	136	410	1.8e-91	0.9923664122137404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	8.62e-89	2	411	3	415	GPI mannosyltransferase
252941	Mannosyl_trans	7.54e-73	136	411	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.
399599	PIG-U	1.07e-04	55	256	47	243	GPI transamidase subunit PIG-U. Many eukaryotic proteins are anchored to the cell surface via glycosylphosphatidylinositol (GPI), which is posttranslationally attached to the carboxyl-terminus by GPI transamidase. The mammalian GPI transamidase is a complex of at least four subunits, GPI8, GAA1, PIG-S, and PIG-T. PIG-U is thought to represent a fifth subunit in this complex and may be involved in the recognition of either the GPI attachment signal or the lipid portion of GPI.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS74503.1|GT50	4.01e-313	1	441	1	441
QSS50664.1|GT50	2.03e-306	1	441	1	441
QSS62928.1|GT50	4.58e-303	1	441	1	441
QKX64577.1|GT50	3.58e-183	1	415	1	416
BCS05340.1|GT50	3.04e-180	3	418	10	423

PDB Hits     

HCBG_07324-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2TXB8|GPI14_ASPOR	7.71e-179	1	417	1	413	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q4WAH2|GPI14_ASPFU	6.84e-175	1	415	1	422	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1
sp|Q5B7W0|GPI14_EMENI	5.19e-174	1	421	1	435	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1
sp|Q4I073|GPI14_GIBZE	5.21e-159	12	421	14	415	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1
sp|Q7S4Z3|GPI14_NEUCR	2.37e-158	3	415	21	486	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000027	0.000000

TMHMM  Annotations     

Start	End
5	27
69	86
90	107
162	184
194	216
221	243
335	352
357	374
389	411