CAZyme Information: HCBG_06544-t26_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCBG_06544-t26_1-p1
• CAZy Family: GT15
• CAZyme Description: alkaline phosphatase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
958	GG663371|CGC2	106444.45	8.3878

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumG186AR	9364	447093	110	9254

• Gene Location: location=GG663371:960072-963738(+)

Full Sequence      

MPPLPGYGAFVQPRIICYHQTYHPNNGGKYMSMLPLTVNNTGITHVILAAIHLNDGPGNI
TLNDHSPEHPRFTSLWTEAGVMRTRGVKVMGMLGGAARGTFERLDQDADIFERYYVPLRD
MIRNHPLDGLDLDVEEEMSLRGIIRLIDRLKADFGEQFIITLAPVATALIEGMNHLSGFN
YKALEAARGSKIAWYNTQFYNGWGTIENLEVYDRILSEGWSPRKVVVGILTNPANGSRGY
VPMNRLSVVLGMLMVKHPTFGGVMGWEYFNALPGDVQQPWQWAALGPQNEIVRHSSSAAR
HNQVPDTGQFMGERAKSRTCFHLANHCDAMPSIQTTLATTSSILMRLSGYIFLRWIPGHQ
FPPLIVTSLLVYLTSVFVIVSGPAFKQVQQRDRSIASARKDTRTAKGSLSSGESSERSRN
GGERSLLSVLATGLPSTHAPYVNLATVGINILIALGTLDAVTRGQYMYPTTELAFSRVGY
VSSTTANILIREPDVKQLPIRISYRVIENGREGESFEGGVIYVINNDTDYTFPITLTGLQ
PSKEYQYSLSNNMSGKFNTAAAPGSAAAYRLSFLSSSCMKANFPYNPLNHPLRIYGLELI
STIVSKLPSFSRPSFMLFLGDFIYIDVPFRWGSSISHYRSEYRKVYASPSWYTGPEPAMN
IPWIHTLDDHEIANDWHLGNETDPYPAAFDTYRHYHMSVNPPTDKSPFSVPFNTTYFSFT
NGPASFFMLDTRTYRSEPLRDNSTMLGSAQLNSLLHWISREEPTGVQWKIIASSVPFSKN
WRIGTEDTWGGFLGERRRIFDAIWRAERELGVRVVLLSGDRHEFGAIRFPDPFLAGTPGQ
KGSGADSSPEDGMGIHEFCTGPLNMFHVPGGIFSQSDDEDVVIKYLPAGNNKLEGAKSRV
LPPGQVVFDKPEGVSVVGKMKCVFGEAQVLVKSLIKSVTGMVKRLVLLLVKKEVVPKG

Enzyme Prediction     

EC	3.2.1.96:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	14	239	3.7e-17	0.6756756756756757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119363	GH18_CTS3_chitinase	1.02e-143	14	271	1	256	GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii. CTS3 has a chitinase-like glycosyl hydrolase family 18 (GH18) domain; and has homologs in bacteria as well as fungi.
401396	PhoD	3.37e-48	612	884	24	314	PhoD-like phosphatase.
277335	MPP_PhoD	1.25e-36	572	864	1	241	Bacillus subtilis PhoD and related proteins, metallophosphatase domain. PhoD (also known as alkaline phosphatase D/APaseD in Bacillus subtilis) is a secreted phosphodiesterase encoded by phoD of the Pho regulon in Bacillus subtilis. PhoD homologs are found in prokaryotes, eukaryotes, and archaea. PhoD contains a twin arginine (RR) motif and is transported by the Tat (Twin-arginine translocation) translocation pathway machinery (TatAyCy). This family also includes the Fusarium oxysporum Fso1 protein. PhoD belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.
226070	PhoD	1.42e-21	527	826	96	420	Phosphodiesterase/alkaline phosphatase D [Inorganic ion transport and metabolism].
119349	GH18_chitinase-like	2.63e-18	15	270	1	209	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW43506.1|GH18	0.0	1	892	1	821
QMW31448.1|GH18	0.0	1	892	1	821
QKX61199.1|GH18	0.0	33	918	1	875
EAA58983.1|GH18	1.03e-281	1	893	36	822
QSS58282.1|GH18	1.23e-225	1	314	1	314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Y8V_A	3.70e-122	1	284	3	282	Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_B Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_C Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_D Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293]
4AC1_X	3.62e-80	13	285	3	274	Chain X, ENDO-N-ACETYL-BETA-D-GLUCOSAMINIDASE [Trichoderma reesei]

Swiss-Prot Hits     

HCBG_06544-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999804	0.000244

TMHMM  Annotations     

There is no transmembrane helices in HCBG_06544-t26_1-p1.