CAZyme Information: HCBG_06209-t26_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCBG_06209-t26_1-p1
• CAZy Family: GH76
• CAZyme Description: endo-1,3-beta-glucanase Engl1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
848	GG663370|CGC3	92025.27	6.3432

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumG186AR	9364	447093	110	9254

• Gene Location: location=GG663370:1238645-1241447(+)

Full Sequence      

MSSWLVAILIMMTMRRFFPGTQALPHCALHQDCHAYPNGTDGLDFGLTSQLPRTTLPAAP
ASLSVGISITISIPLPIRPSTTASQPPPSSITSSAASSSPAPTAPSSSSSSTSTLVPLPK
PPPMNGQNAFEPVGTGPPPANIPSRGDHPVKPDHIVGSTGPIPTNKFFANFFLGSQTGPS
FTHPYGVAWAKGKGPVTSYGLMVSNIELNQLAFGPMSQSIPGNPVQFYINPTGIQSMILS
AAELGPSSVLVVSKPSAFSATILLSPDPGSTSHIAFPLVQGMGFVTAVYTKLQPTVQSGV
FFRQFEQLGSPKPGLFKYRVTLEDGTAWLIYVTSADGTDPQLRLEDHSLIRGIGGFSGTI
QICKNPLGGEGEGIYDRSAGVYAVEVQLAGFVVADQQTGTYSFSWEKQGLDVSTTPLLMF
ALPHHCDSFDKNTKSRMTGLHLRTTTKGMATGIVGDSWTMVETSLPISLGFAPWNAQSKT
SPPLSEPAKEKLKTVAPTELNQDIHQQTYLDSMYFSGKGFGKFSMLVYTVEKLAEDPSLA
ENAFRLLKEAFAKFVRNEQKWPLVYDTVWKGIVSSGSYVTRDPGLDFGNTYYNDHHFHYG
YFILSAAIMGTLDPSWIAGNKDWVNALVRDVSTPVPDDPFFPCFRSFDWYNGHSWAKGLF
ESYDGKDEESSSEDALFAYALKLWGKAIGDASMEARGNLMLAVLARSLHAYFLLRSDNVN
HPANFIANKVTGILFENKVDHTTYFGTNLEYIQGIHMIPLTASSSYTRDQLFVKEEWEAM
FAETAFTPASKVQGGWQGILFANLALIDPSTSWEFFSRDPFDYSKIDGGATRTWYLAFAA
GLGGGPRL

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	156	838	1.9e-222	0.977491961414791

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	0.0	122	846	48	759	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	0.0	484	836	2	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	1.26e-161	148	476	1	321	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS67487.1|GH81	0.0	1	848	5	852
QSS57493.1|GH81	0.0	1	848	5	852
QSS66079.1|GH81	0.0	1	848	5	854
QRD82801.1|GH81	0.0	125	844	192	909
QMW28320.1|GH81	0.0	125	844	192	909

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	9.22e-109	125	840	4	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.68e-108	125	840	29	741	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.03e-105	125	840	4	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	7.92e-28	514	812	340	630	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5UPI_A	1.86e-19	514	829	361	671	Chain A, BH0236 protein [Halalkalibacterium halodurans C-125],5UPM_A Chain A, BH0236 protein [Halalkalibacterium halodurans C-125],5UPN_A Chain A, BH0236 protein [Halalkalibacterium halodurans C-125],5UPO_A Chain A, BH0236 protein [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	0.0	124	841	188	901	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	1.05e-178	132	846	6	706	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|P53753|ENG1_YEAST	8.30e-171	128	842	401	1112	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	8.32e-160	128	842	46	737	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q12168|ENG2_YEAST	8.93e-159	139	839	87	775	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000239	0.999742	CS pos: 23-24. Pr: 0.9559

TMHMM  Annotations     

There is no transmembrane helices in HCBG_06209-t26_1-p1.