CAZyme Information: HCBG_05666-t26_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCBG_05666-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: GDSL Lipase/Acylhydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
224		24260.30	4.4217

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumG186AR	9364	447093	110	9254

• Gene Location: location=GG663369:1119829-1120768(-)

Full Sequence      

MLSGLGLVLALGAQSVLGIGHSAWKLRHMDQLVTFGNSYTDESRLLYFVLNQEAPPIGWI
APENDVTSSGGRIWARYVSDYTGAELYNYAVSGATCSNCITPRYFGPINGIFPSVDQYEI
PTFLADANYRDPQTGQPVLTLTRSNTVYAIWIGTNDLGNGAFIDDAQVAGKTLLDYVECI
FRSIERLYEFHHIGASAECAAIGFVATVCFAGDGWGGDIHVLAG

Enzyme Prediction     

No EC number prediction in HCBG_05666-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	32	189	2e-37	0.5580524344569289

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	2.84e-24	32	189	2	142	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238883	Triacylglycerol_lipase_like	4.86e-04	31	157	3	115	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
395531	Lipase_GDSL	0.002	32	189	1	123	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS54699.1|CE16	6.43e-134	1	190	1	190
QSS59641.1|CE16	2.13e-132	1	190	1	190
QRD06747.1|CE16	2.55e-61	13	188	12	192
QGA14322.1|CE16	4.96e-61	22	188	34	199
QKX58204.1|CE16	5.50e-61	22	189	19	187

PDB Hits     

HCBG_05666-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7J2C6|AES1_HYPJE	5.33e-35	32	188	30	181	Acetylesterase OS=Hypocrea jecorina OX=51453 GN=aes1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.049213	0.950775	CS pos: 18-19. Pr: 0.9060

TMHMM  Annotations     

There is no transmembrane helices in HCBG_05666-t26_1-p1.