CAZyme Information: HCBG_05002-t26_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCBG_05002-t26_1-p1
• CAZy Family: GH47
• CAZyme Description: aminonitrophenyl propanediol resistance protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351	GG663368|CGC5	40852.98	5.1679

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumG186AR	9364	447093	110	9254

• Gene Location: location=GG663368:872438-873646(+)

Full Sequence      

MFFSHLRNLTYPHHLIDLAFLVSDSKDDTLEMLTKMLEELQADPDSKQHYGEISVIEKDF
GQKVNQDVESRHGFAAQASRRKLMAQARNWLLSATLRPTHSWVYWRDADVETAPFTILED
LMRHNKDVIVPNVWRPLPDWLGGEQPYDLNSWKESETALALAETLDEDAVIVEGYAEYAT
WRPHLAYLRDPYGDPDTEMEIDGVGGVSILAKARVFRSGVHFPAFSFEKHAETEAFGKMA
KRMKFSVVGLPHYTIWHLYEPSLDDIRHMEEMERERKEREEEEKKKAELAQLMKEEFKDT
KDEWEKDGKAIQNILKQDELAKKGEKKTTKNEDVKKRSNSGVEDVDKRQQQ

Enzyme Prediction     

No EC number prediction in HCBG_05002-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	1	226	5.1e-110	0.8470149253731343

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	2.17e-140	1	226	38	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS53764.1|GT62	6.16e-242	1	351	125	475
QSS75645.1|GT62	6.16e-242	1	351	125	475
QSS58764.1|GT62	5.33e-216	36	351	1	316
QGI99973.1|GT62	3.61e-190	1	326	91	416
QGI86452.1|GT62	3.61e-190	1	326	91	416

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	1.92e-57	2	262	40	304	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32629|ANP1_YEAST	2.04e-143	1	311	98	408	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|O74745|ANP1_SCHPO	9.41e-143	1	272	115	386	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P23642|VAN1_YEAST	7.39e-112	1	269	208	523	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|Q00314|VAN1_CANAX	1.15e-110	1	272	112	433	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P53697|MNN9_CANAL	1.90e-60	2	260	107	368	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HCBG_05002-t26_1-p1.