CAZyme Information: HCBG_04479-t26_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCBG_04479-t26_1-p1
• CAZy Family: GH36
• CAZyme Description: glyoxal oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
843	GG663367|CGC1	92158.86	5.3665

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumG186AR	9364	447093	110	9254

• Gene Location: location=GG663367:1547581-1550643(+)

Full Sequence      

MTMTRDCSLMAAGEASFDSVDIEHFISNLYVNAAHLRCCCHLSSLSPQHDGAFIPPRKPL
FAIDAFQDIAVCQWELHNSISILGLNADGTSITSTSRLLGSRKYHFRASASCLRPHSASI
PGMFSWSALLTSRNVSLTYLARCEDDNRHVSDDFPISTIRQSPSATQETESVTTSTASDP
LASQEGGYNNCDTQSYSVHTDGNRNTNYMYSPGQSDNLQCGSEHTTMGANSSVSLGAPQN
LMNPSNLSTNKVHRMTLRQKQEEKPKLDLKETIDGLCGPENGDTICGDWPGGSCCSAYGS
GECESGNLFEILSPNTHAPDTIHGTFKVVGQSGVPAMSAALLANGRVVFIDKVENYTQLI
LDNGQYAYSSEYDPSTNMVAPLRYETNAFCSGGAFLEDGRLISIGGNSPLPMDPTVGDGF
RALRYLTRPLDTKAWDGKSWDEPGNKLSTNRWYASAQTLRDGTVFVVSGSLNGLNPSVIA
NNNPTYELLNKDGIPFGHSVLFPILEKNQPYYMYPFLHLLKDGTVFVFVARSAEIFDAHG
QKTVKKLPDLPGDYRSYPNTGGSVLLPLRAANGWDDEIIICGGGAFVGIASPTDPSCGRI
KPLSKDPQWELELMPDGRVMVEGMMLPDGKLIWLNGCNRGAQGFGIAKDPSLDAWIYDPE
APLGRRWSIGGKTEIARMYHSVALVLLDGTVMIAGSNPVEQPILVPNPDVAEQAFATEFR
VEIYTPHYLLDGRDKFRPYDVELPNKHLLVDSEPFTVDFKLHTEPNDLRVVLYHGGFVTH
SLHMGHRMLYLDHVGYQPQSKSQTILVTMPPDNNIAPPGPYVVYVVADGVPSIGVFVMVE
AKR

Enzyme Prediction     

No EC number prediction in HCBG_04479-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA5	323	840	9.1e-148	0.9502664298401421

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399910	Glyoxal_oxid_N	1.35e-54	337	583	1	243	Glyoxal oxidase N-terminus. This family represents the N-terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes. Glyoxal oxidase catalyzes the oxidation of aldehydes to carboxylic acids, coupled with reduction of dioxygen to hydrogen peroxide. It is an essential component of the extracellular lignin degradation pathways of the wood-rot fungus Phanerochaete chrysosporium.
401164	DUF1929	2.05e-31	753	839	10	91	Domain of unknown function (DUF1929). Members of this family adopt a secondary structure consisting of a bundle of seven, mostly antiparallel, beta-strands surrounding a hydrophobic core. The 7 strands are arranged in 2 sheets, in a Greek-key topology. Their precise function, has not, as yet, been defined, though they are mostly found in sugar-utilising enzymes, such as galactose oxidase.
199882	E_set_GO_C	1.43e-28	732	839	1	103	C-terminal Early set domain associated with the catalytic domain of galactose oxidase. E or "early" set domains are associated with the catalytic domain of galactose oxidase at the C-terminal end. Galactose oxidase is an extracellular monomeric enzyme which catalyzes the stereospecific oxidation of a broad range of primary alcohol substrates and possesses a unique mononuclear copper site essential for catalyzing a two-electron transfer reaction during the oxidation of primary alcohols to corresponding aldehydes. The second redox active center necessary for the reaction was found to be situated at a tyrosine residue. The C-terminal domain of galactose oxidase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS69861.1|AA5|CBM18	0.0	227	843	1	631
QSS64055.1|AA5|CBM18	0.0	227	843	1	631
QRC90698.1|AA5|CBM18	1.09e-224	324	840	316	827
QKX63834.1|AA5	5.16e-222	315	840	46	568
QGA21118.1|AA5	4.00e-220	326	840	70	583

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WQ8_A	7.51e-12	334	833	192	653	Chain A, GALACTOSE OXIDASE [Fusarium graminearum]
6XLT_A	6.68e-11	334	833	171	632	Chain A, Galactose oxidase [Fusarium graminearum]
1T2X_A	8.71e-11	334	833	170	631	Glactose oxidase C383S mutant identified by directed evolution [Fusarium sp.]
2EIC_A	1.15e-10	334	833	170	631	Chain A, Galactose oxidase [Fusarium graminearum]
1GOF_A	1.99e-10	334	833	170	631	NOVEL THIOETHER BOND REVEALED BY A 1.7 ANGSTROMS CRYSTAL STRUCTURE OF GALACTOSE OXIDASE [Hypomyces rosellus],1GOG_A NOVEL THIOETHER BOND REVEALED BY A 1.7 ANGSTROMS CRYSTAL STRUCTURE OF GALACTOSE OXIDASE [Hypomyces rosellus],1GOH_A NOVEL THIOETHER BOND REVEALED BY A 1.7 ANGSTROMS CRYSTAL STRUCTURE OF GALACTOSE OXIDASE [Hypomyces rosellus],2EIE_A Chain A, Galactose oxidase [Fusarium graminearum],2JKX_A Chain A, GALACTOSE OXIDASE [Fusarium graminearum],2VZ1_A Chain A, GALACTOSE OXIDASE [Fusarium graminearum],2VZ3_A Chain A, Galactose Oxidase [Fusarium graminearum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q3HRQ2|GLOX_VITPS	6.34e-69	324	833	15	515	Aldehyde oxidase GLOX OS=Vitis pseudoreticulata OX=231512 GN=GLOX PE=2 SV=1
sp|Q9FYG4|GLOX1_ARATH	5.57e-57	331	839	104	614	Aldehyde oxidase GLOX1 OS=Arabidopsis thaliana OX=3702 GN=GLOX1 PE=2 SV=1
sp|A0A2H4HHY6|GLOX_ARTAN	2.88e-52	331	840	76	594	Putative aldehyde oxidase Art an 7 OS=Artemisia annua OX=35608 PE=1 SV=1
sp|D4AUF1|WSCD1_ARTBC	5.44e-52	328	839	425	903	WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07867 PE=1 SV=1
sp|Q01772|GLOX_PHACH	4.88e-49	332	838	35	548	Aldehyde oxidase GLOX OS=Phanerodontia chrysosporium OX=2822231 GN=GLX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000001

TMHMM  Annotations     

There is no transmembrane helices in HCBG_04479-t26_1-p1.