CAZyme Information: HCBG_03438-t26_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCBG_03438-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: GPI mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
2463	GG663366|CGC1	278793.10	7.3289

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumG186AR	9364	447093	110	9254

• Gene Location: location=GG663366:966162-974578(-)

Full Sequence      

MRLTASPPSPRWQWICGTLLDHPLSSLSVLFVFWKLLLLLAVVASPGPGYDTSTTLLPST
VSVSATDSSLLGVGTVIGGGSGWSSSLLKLVRWDAIYFVSIAQRGYIFEQEWAFGYGYTK
LLSFLSSGESFLVFWRVPDSNPDTFHVALAGIGLSHTCHYLSVLSLYGLSRTVFGDGSSR
ALPLLAAALHVISPAGAFLSAPYGEPVFSFLNFTGFYAYASALHDDRRGCVFARDVKFLV
AGGLFATVTTVRSNGVLSGMLFAYDAVVGLAAIVSSGVSLSKLHRMFFVVLGGSLILLGV
VGPQYRAFMVYCRNVDVRRIWCDNTIPSVYTFVQNHYWGSGTFLSYWKVSNLPLFCLAAP
MLVIMGVSSWWPFQSPLDFDIRNKEPRKREEEVSQAEHRRTCLYRLAIPQAVLAALALTN
SHVQIINRISSGYPLWYWYIAQVRTFQLSFGQLVAPKSNELGYLLHQRQTGLYSIPSTSS
RPSSPFAIFTFNANMDSREQLPDILVADHGHSENELSRETSPGGEPTRINGGLLDDHFKK
ARNRPRTYPYFKYLPYTVEDESERQRSLEEILEHLYIAVESGDFNPGAVHWTRELKGWLS
LKFDPTREQRIKLVKFYYELALAPGVDPNVAERFASMFMLLTKRKHYLRPVKDLILDWKP
LYREIKIFVLPSQSGLVHSTNLKRNIKTLTKLCAFAQPYFDPLELPVMLEEFLPHFSTSF
IEGAFVVIGLMNLFLPTTPPLEDREDLLPQHYLPTYFHLWPLVNRSRTFDVTFTDLLSRM
ARDALPASYIPFSEFGIFTSEQTTLIFTAILRLMEIPVGQATSPYSSGVDSLSGLGLMLE
RDFRKHPFTHNIARWIVMSLSPACLETEHSILSKLEGLIEAVETFFHPSNTGVWSKALSQ
LVYYLADFFVMRWNMEHDKENEVPPERRLNDALKRRFVLCLREVTFMGIYSKLGVAMNFA
LSTLQSLAYLEPKLILPGALQRIYPSLQGLVEVHRTTSSLRSLQVLSRLMARTKGFRCHI
TTLLGLVLPGIDANDLEKSLHSLAFIQSVCYNIPFEDLTRDRDDVNGNMLAVQWITGELE
RMENEGASIEMNYDTELTDQEEEMILRSSTTQFGEFLLSFLGRVFTLLENLPDAARVRSG
SPEENVVNTLPATLMPLLASLSPELYDQALIKIVNFVSGHVIHPARDAMAFICNAVCKVN
PEKALKSLVPLLIQSIRTEIDENGAASTRTTGSDILPRDRGLVWNVSMLSMCVVHVGSAV
LKYRTDLFDIAIYMQQKCKGIPTVHVSNFIHHLLLNLTATYVIDHSLYEPDVKEKGIQVE
QWGQRHDPNHLTIKWHVPQREELEFAVELFKSQAENALDQLTSLTSETPSINRDGSGKEW
SDEVTRKLVLLRLIISGISMLFDNKAASYYNTGDRRSHADLDVKMSNANDPCSDEGSSED
DSALDGSDDSAVRQTFQYPTGYLLKEDDPLYISIHEIRRRVGEVLHNVHRFLVEKQEDDV
SCFPPLYTAYRSWFVDVGIEKSAHILDRVTKLLAADTQPYKVSGVRKDYPRPLLVRRANV
YHVQRLRHNASPRPRSKLDETLLLDLAESSVSLYTDIRRSAQGASESALKAIWGSRLLII
PTLIKALQTAIKTNDYPRLKGAIYSILFSSIAKPVGRHWKYAPSLIKAFIEANAVDRPSI
QKLCSGAVYQIMDYGRPMERMAVLDQDIIKSIAPKSDVQAIIDNKREALQKKRALIEQKK
AELSEELTDLARVSHWKMASRTAAIVIGLGLRFDYVASENLVNLIIQGSIDSHPSLRGIY
SQTLVALFTMVDVRAVCSHKYENYIMGVQRFPSKIQVATQPYKKGWTEEYLASFARPEAE
YYVDHDYPGWLVWGKTMPAYKSNIKQDIEYDELEWNVRKQMGKLCTREWFAAFFKYLKQE
PRDVYADKFRMSSAMTLLYVFELMLRDELTAATFEDIKEEIAVVFEDGSDKHQHRATAEI
LGALIGSVTDTSVDKRTLVWEYAFPIVRRIFSDGLTPENSGYWTTFVHMIMQCRDPRRLW
PLLDWLTSFRLDMNSNAAFKESSKINLLHQCILDVGWHFQLEKPIVADFLAHLDHPYKGV
REAIGHTLGSIYRTRYHESYENIQQLIQAQKEASSIGTRPYKPSKEFADTIVDVFSRLER
WRGERVPGQQTPSSYTSGSKTVLLWLDSTLSSHECTQLLQFFPGTFTEELLHMMDVKEDQ
ELQRLAYHVFRHLSNIPHPAGDDSEFVESLIRIGLTSSSWHQRLRVMINIQIMYFRRLFL
LSKIDREKLFDCIACMLEDTQPEVRAGASATLSGMIRCSPASLRNDMVLKLRDRFTKALT
DNPLPKKSRRHGSGVSSGVSTGASTPNPEHTRLVLTRHAAVLGLGALIQAFPYTSPPPQW
MPDVLITLSHKAAGDPGIVGQSVKSIISDFKKTRQDTWHIDVKAFKPDQVEDLAGVLWKS
YFA

Enzyme Prediction     

No EC number prediction in HCBG_03438-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	30	443	7.7e-90	0.9017199017199017

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406818	BLM10_mid	0.0	875	1402	1	499	Proteasome-substrate-size regulator, mid region. The ordered regions of the yeast BLM10 or PA200 (human homolog), full-length protein encode 32 HEAT repeat (HR)-like modules, each comprising two helices joined by a turn, with adjacent repeats connected by a linker. Whereas a standard HEAT repeat is composed of ~50 residues, the BLM10 HEAT repeats are highly variable. The length of helices ranges from 8 to 35 residues, turns range from 2 to 87 residues, and linkers range from 1 to 88 residues, with the longest linker, between HR21 and HR22, containing additional secondary structures (two strands and three helices). BLM10_mid is the middle ordered region of the three in BLM10. BLM10 is found to surround the proteasome entry pore in the 1.2 MDa complex of proteasome and BLM10 to form a largely closed dome that is expected to restrict access of potential substrates. Thus Blm10 and PA200 are predominantly nuclear and stimulate the degradation of model peptides, although they do not appear to stimulate the degradation of proteins, recognize ubiquitin, or utilize ATP.
403208	DUF3437	1.02e-36	2375	2462	1	86	Domain of unknown function (DUF3437). This presumed domain is functionally uncharacterized. This domain is found in eukaryotes. This domain is typically between 142 to 163 amino acids in length.
282094	Mannosyl_trans2	1.81e-31	90	473	57	415	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
406851	BLM10_N	3.37e-30	512	587	1	81	Proteasome-substrate-size regulator, N-terminal. The ordered regions of the yeast BLM10 or PA200 (human homolog), full-length protein encode 32 HEAT repeat (HR)-like modules, each comprising two helices joined by a turn, with adjacent repeats connected by a linker. Whereas a standard HEAT repeat is composed of ~50 residues, the BLM10 HEAT repeats are highly variable. The length of helices ranges from 8 to 35 residues, turns range from 2 to 87 residues, and linkers range from 1 to 88 residues, with the longest linker, between HR21 and HR22, containing additional secondary structures (two strands and three helices). BLM10_N is the N-terminal ordered region of the three in BLM10. BLM10 is found to surround the proteasome entry pore in the 1.2 MDa complex of proteasome and BLM10 to form a largely closed dome that is expected to restrict access of potential substrates. BLM10 and PA200 are predominantly nuclear and stimulate the degradation of model peptides, although they do not appear to stimulate the degradation of proteins, recognize ubiquitin, or utilize ATP.
227829	COG5542	7.05e-13	92	445	76	368	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS49377.1|GT76	1.88e-284	1	441	1	436
QSS60603.1|GT76	2.30e-235	67	441	47	420
BCR82784.1|GT76	1.01e-110	22	440	19	419
CAP97902.1|GT76	5.39e-110	20	440	20	407
QGA17664.1|GT76	6.40e-110	20	441	19	425

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KWX_A	1.71e-96	550	2457	69	1871	cryo-EM structure of human PA200 [Homo sapiens],6KWY_c human PA200-20S complex [Homo sapiens]
6REY_c	2.65e-96	550	2457	34	1836	Human 20S-PA200 Proteasome Complex [Homo sapiens],6REY_d Human 20S-PA200 Proteasome Complex [Homo sapiens]
4V7O_A6	1.13e-63	1465	2463	17	997	Chain A6, Proteasome activator BLM10 [Saccharomyces cerevisiae],4V7O_A8 Chain A8, Proteasome activator BLM10 [Saccharomyces cerevisiae],4V7O_B5 Chain B5, Proteasome activator BLM10 [Saccharomyces cerevisiae],4V7O_B8 Chain B8, Proteasome activator BLM10 [Saccharomyces cerevisiae]
4V7O_A5	2.62e-39	590	1403	4	793	Chain A5, Proteasome activator BLM10 [Saccharomyces cerevisiae],4V7O_A7 Chain A7, Proteasome activator BLM10 [Saccharomyces cerevisiae],4V7O_B4 Chain B4, Proteasome activator BLM10 [Saccharomyces cerevisiae],4V7O_B7 Chain B7, Proteasome activator BLM10 [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UJS7|GPI18_ASPOR	3.82e-102	21	440	16	388	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|P43583|BLM10_YEAST	4.09e-101	590	2463	242	2143	Proteasome activator BLM10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BLM10 PE=1 SV=2
sp|Q5SSW2|PSME4_MOUSE	1.03e-98	519	2457	5	1836	Proteasome activator complex subunit 4 OS=Mus musculus OX=10090 GN=Psme4 PE=1 SV=1
sp|F1R2X6|PSM4B_DANRE	1.07e-96	550	2457	19	1818	Proteasome activator complex subunit 4B OS=Danio rerio OX=7955 GN=psme4b PE=3 SV=2
sp|F1QFR9|PSM4A_DANRE	1.32e-95	550	2457	19	1826	Proteasome activator complex subunit 4A OS=Danio rerio OX=7955 GN=psme4a PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.972862	0.027144

TMHMM  Annotations     

Start	End
27	49
69	91
112	134
147	169
181	203
207	224
255	277
287	309
351	373