CAZyme Information: HCBG_02654-t26_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCBG_02654-t26_1-p1
• CAZy Family: GH13|GH13
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410		43691.45	9.4057

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumG186AR	9364	447093	110	9254

• Gene Location: location=GG663365:1487394-1488699(-)

Full Sequence      

MKTGIFTITVLSLLRVTAALPKGKTAYSPENAKRGQSNNLVDFSTEVIVSADQNVPVRSK
TTGQRSTSANPTLTVVRSLPITKDAANRIAQTPVSQPPRRSSTPAPTPPPGGNSNAVDLS
LPPLPLPSPTKNPLPLSVPPLVSPPKAPGSPNFPGNGLGICYAPYGDNGECKTPQQVESD
FSKFGGFDTVRFYGTDCNQVPMVVAAANKYHKKLFAGIYDIEKLDEALHSLIQGVQSSWA
LIVTVAIGNERVNSGQSSVSEVVASVSKARKVLRDAGYTGPVVTVDTFNALIAHPELCKA
SDFCAANIHAFFDPNTEASNAGGFVKEQQERVSRAAGGKMTVVTESGWPKHGNPNGKAIP
SPENHNLALASLLSAFKGKERNLYLFSAFDDKWKKDDPSTFGAEKYWGIF

Enzyme Prediction     

No EC number prediction in HCBG_02654-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	158	410	1.2e-21	0.9581993569131833

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	3.07e-72	158	410	46	301	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	5.70e-07	332	410	219	297	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS69160.1|GH17	7.89e-283	1	410	1	407
QSS51160.1|GH17	6.07e-271	1	409	1	406
QSS63389.1|GH17	9.27e-259	24	409	2	387
BCS13276.1|GH17	1.27e-89	140	409	94	360
BCS01560.1|GH17	1.27e-89	140	409	94	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.89e-11	149	409	33	281	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.11e-10	149	409	33	281	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59XX2|MP65_CANAL	2.66e-74	155	410	124	376	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|Q04951|SCW10_YEAST	4.89e-71	159	409	138	385	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|P53334|SCW4_YEAST	7.81e-65	159	409	135	382	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|P53189|SCW11_YEAST	2.35e-43	160	409	284	537	Probable family 17 glucosidase SCW11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW11 PE=1 SV=1
sp|B0Y9Q9|BTGE_ASPFC	4.07e-41	158	410	309	561	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000254	0.999720	CS pos: 19-20. Pr: 0.9634

TMHMM  Annotations     

There is no transmembrane helices in HCBG_02654-t26_1-p1.