CAZyme Information: HCBG_01384-t26_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCBG_01384-t26_1-p1
• CAZy Family: AA7
• CAZyme Description: exo-beta-1,3-glucanase Exg0

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
946		101748.56	6.1663

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumG186AR	9364	447093	110	9254

• Gene Location: location=GG663364:501548-504960(+)

Full Sequence      

MVAGAGWAQLSFQGPRFCHRITQRISDKLSAVPGTAPPGTASSVPWPLGHNTMMLSSSVL
WVVTHLWLLLGGLTSLANAIPMPQGNPTPQASGFWVGSIDRRGSPAFRTASGEYQVYRNV
KEFGAKGDGTTDDTEAINKAISTGNRCGLGCDSSTVTPAIVYFPAGTYVVSKPIIQYYYT
QLVGDALNLPVIKAASSFQGIAVIDADPYTDQGTNWYNFNQVLICFDLVYRDADNDSRIS
VRDFYWQVAQASSLQNIRFEMVQGGGEANRQQGIFMDNGSGGFMTDLVFNGGNYGAFLGN
QQFTTRNLTFTNCNTAVFMNWNWAWTFKSVTVNNCGVGLNMSNGGFNQTVGSVLILDSKF
IGTPKGVVTSYNDKSVPETGGTLILDNVDFTGSDVAVAHLDGSVVLKGGSVVSSWAQGNA
FTSGSYATIQNSKREPEPRVKGPVPVYTVERIIKRDSCKARYPPPPQPAPISQAPTPSPL
PPPFTGKYPTPSQDKPEGTESKSPTVSPSSVSSSVPPSPTPSPTETSPAACPTAPPKKAR
ISSRISSPAKPAVLLDPSGKVFERTKPQYEGVPKGSFISVKGAGAKGDGVTDDTKAIQAA
LDSAQAGQIVYFDHGAYVITSTIKVPKEIKITGEIWPLLMASGPAFSDESKPIPMLQVGQ
KGDKGNVEISDLVLETKGPAPGAILVEWNVAETTQGSVGMWDVHMRIGGSAGTELQSDHC
AKTPKSKTVPDPKCVGAFMLMHITKEASGYFENNWLWVSDHELDLADHGQINIYNGRGLL
IESTGPVWLYGSASEHSQLYQYSIVGAKNVFMALIQVETPYYQANPNALVPFKPNSDFHD
PDYSHCKTDACRKAWGLRILDSTDVFIYGGGLYSFFENYSQECLATESCQENMIEVDCSP
VHLFGISTKASTNMITRTNGGQGLVKQIDNRNNFCSTLAVFEQASE

Enzyme Prediction     

EC	3.2.1.58:16	3.2.1.58:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	537	941	2.3e-167	0.5351351351351351
GH55	88	430	3.9e-125	0.4594594594594595

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403800	Pectate_lyase_3	5.18e-87	117	340	1	213	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
403800	Pectate_lyase_3	2.73e-13	577	695	1	128	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
227721	Pgu1	3.53e-05	30	169	1	125	Polygalacturonase [Carbohydrate transport and metabolism].
314993	End_N_terminal	7.80e-04	585	610	1	26	N terminal extension of bacteriophage endosialidase. This domain family is found in bacteria and viruses, and is approximately 70 amino acids in length. This domain is found in the bacteriophage protein endosialidase. The two N-terminal domains (this domain and the beta propeller) assemble in the compact 'cap' whereas the C-terminal domain forms an extended tail-like structure. The very N-terminal part of the 'cap' region (residues 246 to 312) holds the only alpha-helix of the protein and is presumably the residual part of the deleted N-terminal head-binding domain. The endosialidase protein complexes to form homotrimeric molecules.
227721	Pgu1	0.003	579	618	84	125	Polygalacturonase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS54990.1|GH55	0.0	53	946	1	895
QSS65232.1|GH55	0.0	53	946	1	895
QMW47168.1|GH55	0.0	50	944	5	950
QRD91479.1|GH55	0.0	50	944	5	950
QMW35104.1|GH55	0.0	50	944	5	950

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M5Z_A	5.04e-281	92	945	4	757	Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]
3EQN_A	1.11e-189	81	941	14	755	Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]
7CHU_A	1.48e-07	119	194	76	149	Chain A, Putative pectin lyase [Geobacillus virus E2],7CHU_B Chain B, Putative pectin lyase [Geobacillus virus E2],7CHU_C Chain C, Putative pectin lyase [Geobacillus virus E2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B0V1|E13B_ARTBC	0.0	65	945	13	877	Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02077 PE=1 SV=1
sp|P49426|EXG1_COCCA	1.27e-176	93	938	47	781	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1
sp|P53626|E13B_TRIHA	1.93e-44	546	920	356	737	Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum OX=5544 GN=bgn13.1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998760	0.001240

TMHMM  Annotations     

There is no transmembrane helices in HCBG_01384-t26_1-p1.